vendor/golang.org/x/text: Vendor collate and language

Following the vndr docs [1]:

  $ go get -u github.com/LK4D4/vndr
  $ vndr golang.org/x/text
  $ git add -A vendor/golang.org/x/text

The targeted 'git add' was because we seem to have versioned some test
files (e.g. vendor/github.com/varlink/go/varlink/varlink_test.go in
8493dba2 (Initial varlink implementation, 2018-03-26, #627).  I don't
know why, possibly an old vndr version?  But either way, I'm punting
that particular issue to a separate branch.

[1]: https://github.com/LK4D4/vndr/blob/1fc68ee0c852556a9ed53cbde16247033f104111/README.md

Signed-off-by: W. Trevor King <wking@tremily.us>

Closes: #686
Approved by: mheon

11 files changed, 7790 insertions, 0 deletions

diff --git a/vendor/golang.org/x/text/language/common.go b/vendor/golang.org/x/text/language/common.go
new file mode 100644
index 000000000..a255bb0a5
--- /dev/null
+++ b/vendor/golang.org/x/text/language/common.go
@@ -0,0 +1,16 @@
+// This file was generated by go generate; DO NOT EDIT
+
+package language
+
+// This file contains code common to the maketables.go and the package code.
+
+// langAliasType is the type of an alias in langAliasMap.
+type langAliasType int8
+
+const (
+	langDeprecated langAliasType = iota
+	langMacro
+	langLegacy
+
+	langAliasTypeUnknown langAliasType = -1
+)
diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go
new file mode 100644
index 000000000..101fd23c1
--- /dev/null
+++ b/vendor/golang.org/x/text/language/coverage.go
@@ -0,0 +1,197 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+	"fmt"
+	"sort"
+)
+
+// The Coverage interface is used to define the level of coverage of an
+// internationalization service. Note that not all types are supported by all
+// services. As lists may be generated on the fly, it is recommended that users
+// of a Coverage cache the results.
+type Coverage interface {
+	// Tags returns the list of supported tags.
+	Tags() []Tag
+
+	// BaseLanguages returns the list of supported base languages.
+	BaseLanguages() []Base
+
+	// Scripts returns the list of supported scripts.
+	Scripts() []Script
+
+	// Regions returns the list of supported regions.
+	Regions() []Region
+}
+
+var (
+	// Supported defines a Coverage that lists all supported subtags. Tags
+	// always returns nil.
+	Supported Coverage = allSubtags{}
+)
+
+// TODO:
+// - Support Variants, numbering systems.
+// - CLDR coverage levels.
+// - Set of common tags defined in this package.
+
+type allSubtags struct{}
+
+// Regions returns the list of supported regions. As all regions are in a
+// consecutive range, it simply returns a slice of numbers in increasing order.
+// The "undefined" region is not returned.
+func (s allSubtags) Regions() []Region {
+	reg := make([]Region, numRegions)
+	for i := range reg {
+		reg[i] = Region{regionID(i + 1)}
+	}
+	return reg
+}
+
+// Scripts returns the list of supported scripts. As all scripts are in a
+// consecutive range, it simply returns a slice of numbers in increasing order.
+// The "undefined" script is not returned.
+func (s allSubtags) Scripts() []Script {
+	scr := make([]Script, numScripts)
+	for i := range scr {
+		scr[i] = Script{scriptID(i + 1)}
+	}
+	return scr
+}
+
+// BaseLanguages returns the list of all supported base languages. It generates
+// the list by traversing the internal structures.
+func (s allSubtags) BaseLanguages() []Base {
+	base := make([]Base, 0, numLanguages)
+	for i := 0; i < langNoIndexOffset; i++ {
+		// We included "und" already for the value 0.
+		if i != nonCanonicalUnd {
+			base = append(base, Base{langID(i)})
+		}
+	}
+	i := langNoIndexOffset
+	for _, v := range langNoIndex {
+		for k := 0; k < 8; k++ {
+			if v&1 == 1 {
+				base = append(base, Base{langID(i)})
+			}
+			v >>= 1
+			i++
+		}
+	}
+	return base
+}
+
+// Tags always returns nil.
+func (s allSubtags) Tags() []Tag {
+	return nil
+}
+
+// coverage is used used by NewCoverage which is used as a convenient way for
+// creating Coverage implementations for partially defined data. Very often a
+// package will only need to define a subset of slices. coverage provides a
+// convenient way to do this. Moreover, packages using NewCoverage, instead of
+// their own implementation, will not break if later new slice types are added.
+type coverage struct {
+	tags    func() []Tag
+	bases   func() []Base
+	scripts func() []Script
+	regions func() []Region
+}
+
+func (s *coverage) Tags() []Tag {
+	if s.tags == nil {
+		return nil
+	}
+	return s.tags()
+}
+
+// bases implements sort.Interface and is used to sort base languages.
+type bases []Base
+
+func (b bases) Len() int {
+	return len(b)
+}
+
+func (b bases) Swap(i, j int) {
+	b[i], b[j] = b[j], b[i]
+}
+
+func (b bases) Less(i, j int) bool {
+	return b[i].langID < b[j].langID
+}
+
+// BaseLanguages returns the result from calling s.bases if it is specified or
+// otherwise derives the set of supported base languages from tags.
+func (s *coverage) BaseLanguages() []Base {
+	if s.bases == nil {
+		tags := s.Tags()
+		if len(tags) == 0 {
+			return nil
+		}
+		a := make([]Base, len(tags))
+		for i, t := range tags {
+			a[i] = Base{langID(t.lang)}
+		}
+		sort.Sort(bases(a))
+		k := 0
+		for i := 1; i < len(a); i++ {
+			if a[k] != a[i] {
+				k++
+				a[k] = a[i]
+			}
+		}
+		return a[:k+1]
+	}
+	return s.bases()
+}
+
+func (s *coverage) Scripts() []Script {
+	if s.scripts == nil {
+		return nil
+	}
+	return s.scripts()
+}
+
+func (s *coverage) Regions() []Region {
+	if s.regions == nil {
+		return nil
+	}
+	return s.regions()
+}
+
+// NewCoverage returns a Coverage for the given lists. It is typically used by
+// packages providing internationalization services to define their level of
+// coverage. A list may be of type []T or func() []T, where T is either Tag,
+// Base, Script or Region. The returned Coverage derives the value for Bases
+// from Tags if no func or slice for []Base is specified. For other unspecified
+// types the returned Coverage will return nil for the respective methods.
+func NewCoverage(list ...interface{}) Coverage {
+	s := &coverage{}
+	for _, x := range list {
+		switch v := x.(type) {
+		case func() []Base:
+			s.bases = v
+		case func() []Script:
+			s.scripts = v
+		case func() []Region:
+			s.regions = v
+		case func() []Tag:
+			s.tags = v
+		case []Base:
+			s.bases = func() []Base { return v }
+		case []Script:
+			s.scripts = func() []Script { return v }
+		case []Region:
+			s.regions = func() []Region { return v }
+		case []Tag:
+			s.tags = func() []Tag { return v }
+		default:
+			panic(fmt.Sprintf("language: unsupported set type %T", v))
+		}
+	}
+	return s
+}
diff --git a/vendor/golang.org/x/text/language/go1_1.go b/vendor/golang.org/x/text/language/go1_1.go
new file mode 100644
index 000000000..380f4c09f
--- /dev/null
+++ b/vendor/golang.org/x/text/language/go1_1.go
@@ -0,0 +1,38 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build !go1.2
+
+package language
+
+import "sort"
+
+func sortStable(s sort.Interface) {
+	ss := stableSort{
+		s:   s,
+		pos: make([]int, s.Len()),
+	}
+	for i := range ss.pos {
+		ss.pos[i] = i
+	}
+	sort.Sort(&ss)
+}
+
+type stableSort struct {
+	s   sort.Interface
+	pos []int
+}
+
+func (s *stableSort) Len() int {
+	return len(s.pos)
+}
+
+func (s *stableSort) Less(i, j int) bool {
+	return s.s.Less(i, j) || !s.s.Less(j, i) && s.pos[i] < s.pos[j]
+}
+
+func (s *stableSort) Swap(i, j int) {
+	s.s.Swap(i, j)
+	s.pos[i], s.pos[j] = s.pos[j], s.pos[i]
+}
diff --git a/vendor/golang.org/x/text/language/go1_2.go b/vendor/golang.org/x/text/language/go1_2.go
new file mode 100644
index 000000000..38268c57a
--- /dev/null
+++ b/vendor/golang.org/x/text/language/go1_2.go
@@ -0,0 +1,11 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build go1.2
+
+package language
+
+import "sort"
+
+var sortStable = sort.Stable
diff --git a/vendor/golang.org/x/text/language/index.go b/vendor/golang.org/x/text/language/index.go
new file mode 100644
index 000000000..50c752186
--- /dev/null
+++ b/vendor/golang.org/x/text/language/index.go
@@ -0,0 +1,767 @@
+// This file was generated by go generate; DO NOT EDIT
+
+package language
+
+// NumCompactTags is the number of common tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = 752
+
+var specialTags = []Tag{ // 2 elements
+	0: {lang: 0xd5, region: 0x6d, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"},
+	1: {lang: 0x134, region: 0x134, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"},
+} // Size: 72 bytes
+
+var coreTags = map[uint32]uint16{
+	0x0:        0,   // und
+	0x01500000: 3,   // af
+	0x015000d1: 4,   // af-NA
+	0x01500160: 5,   // af-ZA
+	0x01b00000: 6,   // agq
+	0x01b00051: 7,   // agq-CM
+	0x02000000: 8,   // ak
+	0x0200007f: 9,   // ak-GH
+	0x02600000: 10,  // am
+	0x0260006e: 11,  // am-ET
+	0x03900000: 12,  // ar
+	0x03900001: 13,  // ar-001
+	0x03900022: 14,  // ar-AE
+	0x03900038: 15,  // ar-BH
+	0x03900061: 16,  // ar-DJ
+	0x03900066: 17,  // ar-DZ
+	0x0390006a: 18,  // ar-EG
+	0x0390006b: 19,  // ar-EH
+	0x0390006c: 20,  // ar-ER
+	0x03900096: 21,  // ar-IL
+	0x0390009a: 22,  // ar-IQ
+	0x039000a0: 23,  // ar-JO
+	0x039000a7: 24,  // ar-KM
+	0x039000ab: 25,  // ar-KW
+	0x039000af: 26,  // ar-LB
+	0x039000b8: 27,  // ar-LY
+	0x039000b9: 28,  // ar-MA
+	0x039000c8: 29,  // ar-MR
+	0x039000e0: 30,  // ar-OM
+	0x039000ec: 31,  // ar-PS
+	0x039000f2: 32,  // ar-QA
+	0x03900107: 33,  // ar-SA
+	0x0390010a: 34,  // ar-SD
+	0x03900114: 35,  // ar-SO
+	0x03900116: 36,  // ar-SS
+	0x0390011b: 37,  // ar-SY
+	0x0390011f: 38,  // ar-TD
+	0x03900127: 39,  // ar-TN
+	0x0390015d: 40,  // ar-YE
+	0x03f00000: 41,  // ars
+	0x04200000: 42,  // as
+	0x04200098: 43,  // as-IN
+	0x04300000: 44,  // asa
+	0x0430012e: 45,  // asa-TZ
+	0x04700000: 46,  // ast
+	0x0470006d: 47,  // ast-ES
+	0x05700000: 48,  // az
+	0x0571e000: 49,  // az-Cyrl
+	0x0571e031: 50,  // az-Cyrl-AZ
+	0x05752000: 51,  // az-Latn
+	0x05752031: 52,  // az-Latn-AZ
+	0x05d00000: 53,  // bas
+	0x05d00051: 54,  // bas-CM
+	0x07000000: 55,  // be
+	0x07000046: 56,  // be-BY
+	0x07400000: 57,  // bem
+	0x07400161: 58,  // bem-ZM
+	0x07800000: 59,  // bez
+	0x0780012e: 60,  // bez-TZ
+	0x07d00000: 61,  // bg
+	0x07d00037: 62,  // bg-BG
+	0x08100000: 63,  // bh
+	0x09e00000: 64,  // bm
+	0x09e000c2: 65,  // bm-ML
+	0x0a300000: 66,  // bn
+	0x0a300034: 67,  // bn-BD
+	0x0a300098: 68,  // bn-IN
+	0x0a700000: 69,  // bo
+	0x0a700052: 70,  // bo-CN
+	0x0a700098: 71,  // bo-IN
+	0x0b000000: 72,  // br
+	0x0b000077: 73,  // br-FR
+	0x0b300000: 74,  // brx
+	0x0b300098: 75,  // brx-IN
+	0x0b500000: 76,  // bs
+	0x0b51e000: 77,  // bs-Cyrl
+	0x0b51e032: 78,  // bs-Cyrl-BA
+	0x0b552000: 79,  // bs-Latn
+	0x0b552032: 80,  // bs-Latn-BA
+	0x0d500000: 81,  // ca
+	0x0d500021: 82,  // ca-AD
+	0x0d50006d: 83,  // ca-ES
+	0x0d500077: 84,  // ca-FR
+	0x0d50009d: 85,  // ca-IT
+	0x0da00000: 86,  // ce
+	0x0da00105: 87,  // ce-RU
+	0x0dd00000: 88,  // cgg
+	0x0dd00130: 89,  // cgg-UG
+	0x0e300000: 90,  // chr
+	0x0e300134: 91,  // chr-US
+	0x0e700000: 92,  // ckb
+	0x0e70009a: 93,  // ckb-IQ
+	0x0e70009b: 94,  // ckb-IR
+	0x0f600000: 95,  // cs
+	0x0f60005d: 96,  // cs-CZ
+	0x0fa00000: 97,  // cu
+	0x0fa00105: 98,  // cu-RU
+	0x0fc00000: 99,  // cy
+	0x0fc0007a: 100, // cy-GB
+	0x0fd00000: 101, // da
+	0x0fd00062: 102, // da-DK
+	0x0fd00081: 103, // da-GL
+	0x10400000: 104, // dav
+	0x104000a3: 105, // dav-KE
+	0x10900000: 106, // de
+	0x1090002d: 107, // de-AT
+	0x10900035: 108, // de-BE
+	0x1090004d: 109, // de-CH
+	0x1090005f: 110, // de-DE
+	0x1090009d: 111, // de-IT
+	0x109000b1: 112, // de-LI
+	0x109000b6: 113, // de-LU
+	0x11300000: 114, // dje
+	0x113000d3: 115, // dje-NE
+	0x11b00000: 116, // dsb
+	0x11b0005f: 117, // dsb-DE
+	0x12000000: 118, // dua
+	0x12000051: 119, // dua-CM
+	0x12400000: 120, // dv
+	0x12700000: 121, // dyo
+	0x12700113: 122, // dyo-SN
+	0x12900000: 123, // dz
+	0x12900042: 124, // dz-BT
+	0x12b00000: 125, // ebu
+	0x12b000a3: 126, // ebu-KE
+	0x12c00000: 127, // ee
+	0x12c0007f: 128, // ee-GH
+	0x12c00121: 129, // ee-TG
+	0x13100000: 130, // el
+	0x1310005c: 131, // el-CY
+	0x13100086: 132, // el-GR
+	0x13400000: 133, // en
+	0x13400001: 134, // en-001
+	0x1340001a: 135, // en-150
+	0x13400024: 136, // en-AG
+	0x13400025: 137, // en-AI
+	0x1340002c: 138, // en-AS
+	0x1340002d: 139, // en-AT
+	0x1340002e: 140, // en-AU
+	0x13400033: 141, // en-BB
+	0x13400035: 142, // en-BE
+	0x13400039: 143, // en-BI
+	0x1340003c: 144, // en-BM
+	0x13400041: 145, // en-BS
+	0x13400045: 146, // en-BW
+	0x13400047: 147, // en-BZ
+	0x13400048: 148, // en-CA
+	0x13400049: 149, // en-CC
+	0x1340004d: 150, // en-CH
+	0x1340004f: 151, // en-CK
+	0x13400051: 152, // en-CM
+	0x1340005b: 153, // en-CX
+	0x1340005c: 154, // en-CY
+	0x1340005f: 155, // en-DE
+	0x13400060: 156, // en-DG
+	0x13400062: 157, // en-DK
+	0x13400063: 158, // en-DM
+	0x1340006c: 159, // en-ER
+	0x13400071: 160, // en-FI
+	0x13400072: 161, // en-FJ
+	0x13400073: 162, // en-FK
+	0x13400074: 163, // en-FM
+	0x1340007a: 164, // en-GB
+	0x1340007b: 165, // en-GD
+	0x1340007e: 166, // en-GG
+	0x1340007f: 167, // en-GH
+	0x13400080: 168, // en-GI
+	0x13400082: 169, // en-GM
+	0x13400089: 170, // en-GU
+	0x1340008b: 171, // en-GY
+	0x1340008c: 172, // en-HK
+	0x13400095: 173, // en-IE
+	0x13400096: 174, // en-IL
+	0x13400097: 175, // en-IM
+	0x13400098: 176, // en-IN
+	0x13400099: 177, // en-IO
+	0x1340009e: 178, // en-JE
+	0x1340009f: 179, // en-JM
+	0x134000a3: 180, // en-KE
+	0x134000a6: 181, // en-KI
+	0x134000a8: 182, // en-KN
+	0x134000ac: 183, // en-KY
+	0x134000b0: 184, // en-LC
+	0x134000b3: 185, // en-LR
+	0x134000b4: 186, // en-LS
+	0x134000be: 187, // en-MG
+	0x134000bf: 188, // en-MH
+	0x134000c5: 189, // en-MO
+	0x134000c6: 190, // en-MP
+	0x134000c9: 191, // en-MS
+	0x134000ca: 192, // en-MT
+	0x134000cb: 193, // en-MU
+	0x134000cd: 194, // en-MW
+	0x134000cf: 195, // en-MY
+	0x134000d1: 196, // en-NA
+	0x134000d4: 197, // en-NF
+	0x134000d5: 198, // en-NG
+	0x134000d8: 199, // en-NL
+	0x134000dc: 200, // en-NR
+	0x134000de: 201, // en-NU
+	0x134000df: 202, // en-NZ
+	0x134000e5: 203, // en-PG
+	0x134000e6: 204, // en-PH
+	0x134000e7: 205, // en-PK
+	0x134000ea: 206, // en-PN
+	0x134000eb: 207, // en-PR
+	0x134000ef: 208, // en-PW
+	0x13400106: 209, // en-RW
+	0x13400108: 210, // en-SB
+	0x13400109: 211, // en-SC
+	0x1340010a: 212, // en-SD
+	0x1340010b: 213, // en-SE
+	0x1340010c: 214, // en-SG
+	0x1340010d: 215, // en-SH
+	0x1340010e: 216, // en-SI
+	0x13400111: 217, // en-SL
+	0x13400116: 218, // en-SS
+	0x1340011a: 219, // en-SX
+	0x1340011c: 220, // en-SZ
+	0x1340011e: 221, // en-TC
+	0x13400124: 222, // en-TK
+	0x13400128: 223, // en-TO
+	0x1340012b: 224, // en-TT
+	0x1340012c: 225, // en-TV
+	0x1340012e: 226, // en-TZ
+	0x13400130: 227, // en-UG
+	0x13400132: 228, // en-UM
+	0x13400134: 229, // en-US
+	0x13400138: 230, // en-VC
+	0x1340013b: 231, // en-VG
+	0x1340013c: 232, // en-VI
+	0x1340013e: 233, // en-VU
+	0x13400141: 234, // en-WS
+	0x13400160: 235, // en-ZA
+	0x13400161: 236, // en-ZM
+	0x13400163: 237, // en-ZW
+	0x13700000: 238, // eo
+	0x13700001: 239, // eo-001
+	0x13900000: 240, // es
+	0x1390001e: 241, // es-419
+	0x1390002b: 242, // es-AR
+	0x1390003e: 243, // es-BO
+	0x13900040: 244, // es-BR
+	0x13900050: 245, // es-CL
+	0x13900053: 246, // es-CO
+	0x13900055: 247, // es-CR
+	0x13900058: 248, // es-CU
+	0x13900064: 249, // es-DO
+	0x13900067: 250, // es-EA
+	0x13900068: 251, // es-EC
+	0x1390006d: 252, // es-ES
+	0x13900085: 253, // es-GQ
+	0x13900088: 254, // es-GT
+	0x1390008e: 255, // es-HN
+	0x13900093: 256, // es-IC
+	0x139000ce: 257, // es-MX
+	0x139000d7: 258, // es-NI
+	0x139000e1: 259, // es-PA
+	0x139000e3: 260, // es-PE
+	0x139000e6: 261, // es-PH
+	0x139000eb: 262, // es-PR
+	0x139000f0: 263, // es-PY
+	0x13900119: 264, // es-SV
+	0x13900134: 265, // es-US
+	0x13900135: 266, // es-UY
+	0x1390013a: 267, // es-VE
+	0x13b00000: 268, // et
+	0x13b00069: 269, // et-EE
+	0x14000000: 270, // eu
+	0x1400006d: 271, // eu-ES
+	0x14100000: 272, // ewo
+	0x14100051: 273, // ewo-CM
+	0x14300000: 274, // fa
+	0x14300023: 275, // fa-AF
+	0x1430009b: 276, // fa-IR
+	0x14900000: 277, // ff
+	0x14900051: 278, // ff-CM
+	0x14900083: 279, // ff-GN
+	0x149000c8: 280, // ff-MR
+	0x14900113: 281, // ff-SN
+	0x14c00000: 282, // fi
+	0x14c00071: 283, // fi-FI
+	0x14e00000: 284, // fil
+	0x14e000e6: 285, // fil-PH
+	0x15300000: 286, // fo
+	0x15300062: 287, // fo-DK
+	0x15300075: 288, // fo-FO
+	0x15900000: 289, // fr
+	0x15900035: 290, // fr-BE
+	0x15900036: 291, // fr-BF
+	0x15900039: 292, // fr-BI
+	0x1590003a: 293, // fr-BJ
+	0x1590003b: 294, // fr-BL
+	0x15900048: 295, // fr-CA
+	0x1590004a: 296, // fr-CD
+	0x1590004b: 297, // fr-CF
+	0x1590004c: 298, // fr-CG
+	0x1590004d: 299, // fr-CH
+	0x1590004e: 300, // fr-CI
+	0x15900051: 301, // fr-CM
+	0x15900061: 302, // fr-DJ
+	0x15900066: 303, // fr-DZ
+	0x15900077: 304, // fr-FR
+	0x15900079: 305, // fr-GA
+	0x1590007d: 306, // fr-GF
+	0x15900083: 307, // fr-GN
+	0x15900084: 308, // fr-GP
+	0x15900085: 309, // fr-GQ
+	0x15900090: 310, // fr-HT
+	0x159000a7: 311, // fr-KM
+	0x159000b6: 312, // fr-LU
+	0x159000b9: 313, // fr-MA
+	0x159000ba: 314, // fr-MC
+	0x159000bd: 315, // fr-MF
+	0x159000be: 316, // fr-MG
+	0x159000c2: 317, // fr-ML
+	0x159000c7: 318, // fr-MQ
+	0x159000c8: 319, // fr-MR
+	0x159000cb: 320, // fr-MU
+	0x159000d2: 321, // fr-NC
+	0x159000d3: 322, // fr-NE
+	0x159000e4: 323, // fr-PF
+	0x159000e9: 324, // fr-PM
+	0x15900101: 325, // fr-RE
+	0x15900106: 326, // fr-RW
+	0x15900109: 327, // fr-SC
+	0x15900113: 328, // fr-SN
+	0x1590011b: 329, // fr-SY
+	0x1590011f: 330, // fr-TD
+	0x15900121: 331, // fr-TG
+	0x15900127: 332, // fr-TN
+	0x1590013e: 333, // fr-VU
+	0x1590013f: 334, // fr-WF
+	0x1590015e: 335, // fr-YT
+	0x16400000: 336, // fur
+	0x1640009d: 337, // fur-IT
+	0x16800000: 338, // fy
+	0x168000d8: 339, // fy-NL
+	0x16900000: 340, // ga
+	0x16900095: 341, // ga-IE
+	0x17800000: 342, // gd
+	0x1780007a: 343, // gd-GB
+	0x18a00000: 344, // gl
+	0x18a0006d: 345, // gl-ES
+	0x19c00000: 346, // gsw
+	0x19c0004d: 347, // gsw-CH
+	0x19c00077: 348, // gsw-FR
+	0x19c000b1: 349, // gsw-LI
+	0x19d00000: 350, // gu
+	0x19d00098: 351, // gu-IN
+	0x1a200000: 352, // guw
+	0x1a400000: 353, // guz
+	0x1a4000a3: 354, // guz-KE
+	0x1a500000: 355, // gv
+	0x1a500097: 356, // gv-IM
+	0x1ad00000: 357, // ha
+	0x1ad0007f: 358, // ha-GH
+	0x1ad000d3: 359, // ha-NE
+	0x1ad000d5: 360, // ha-NG
+	0x1b100000: 361, // haw
+	0x1b100134: 362, // haw-US
+	0x1b500000: 363, // he
+	0x1b500096: 364, // he-IL
+	0x1b700000: 365, // hi
+	0x1b700098: 366, // hi-IN
+	0x1ca00000: 367, // hr
+	0x1ca00032: 368, // hr-BA
+	0x1ca0008f: 369, // hr-HR
+	0x1cb00000: 370, // hsb
+	0x1cb0005f: 371, // hsb-DE
+	0x1ce00000: 372, // hu
+	0x1ce00091: 373, // hu-HU
+	0x1d000000: 374, // hy
+	0x1d000027: 375, // hy-AM
+	0x1da00000: 376, // id
+	0x1da00094: 377, // id-ID
+	0x1df00000: 378, // ig
+	0x1df000d5: 379, // ig-NG
+	0x1e200000: 380, // ii
+	0x1e200052: 381, // ii-CN
+	0x1f000000: 382, // is
+	0x1f00009c: 383, // is-IS
+	0x1f100000: 384, // it
+	0x1f10004d: 385, // it-CH
+	0x1f10009d: 386, // it-IT
+	0x1f100112: 387, // it-SM
+	0x1f200000: 388, // iu
+	0x1f800000: 389, // ja
+	0x1f8000a1: 390, // ja-JP
+	0x1fb00000: 391, // jbo
+	0x1ff00000: 392, // jgo
+	0x1ff00051: 393, // jgo-CM
+	0x20200000: 394, // jmc
+	0x2020012e: 395, // jmc-TZ
+	0x20600000: 396, // jv
+	0x20800000: 397, // ka
+	0x2080007c: 398, // ka-GE
+	0x20a00000: 399, // kab
+	0x20a00066: 400, // kab-DZ
+	0x20e00000: 401, // kaj
+	0x20f00000: 402, // kam
+	0x20f000a3: 403, // kam-KE
+	0x21700000: 404, // kcg
+	0x21b00000: 405, // kde
+	0x21b0012e: 406, // kde-TZ
+	0x21f00000: 407, // kea
+	0x21f00059: 408, // kea-CV
+	0x22c00000: 409, // khq
+	0x22c000c2: 410, // khq-ML
+	0x23100000: 411, // ki
+	0x231000a3: 412, // ki-KE
+	0x23a00000: 413, // kk
+	0x23a000ad: 414, // kk-KZ
+	0x23c00000: 415, // kkj
+	0x23c00051: 416, // kkj-CM
+	0x23d00000: 417, // kl
+	0x23d00081: 418, // kl-GL
+	0x23e00000: 419, // kln
+	0x23e000a3: 420, // kln-KE
+	0x24200000: 421, // km
+	0x242000a5: 422, // km-KH
+	0x24900000: 423, // kn
+	0x24900098: 424, // kn-IN
+	0x24b00000: 425, // ko
+	0x24b000a9: 426, // ko-KP
+	0x24b000aa: 427, // ko-KR
+	0x24d00000: 428, // kok
+	0x24d00098: 429, // kok-IN
+	0x26100000: 430, // ks
+	0x26100098: 431, // ks-IN
+	0x26200000: 432, // ksb
+	0x2620012e: 433, // ksb-TZ
+	0x26400000: 434, // ksf
+	0x26400051: 435, // ksf-CM
+	0x26500000: 436, // ksh
+	0x2650005f: 437, // ksh-DE
+	0x26b00000: 438, // ku
+	0x27800000: 439, // kw
+	0x2780007a: 440, // kw-GB
+	0x28100000: 441, // ky
+	0x281000a4: 442, // ky-KG
+	0x28800000: 443, // lag
+	0x2880012e: 444, // lag-TZ
+	0x28c00000: 445, // lb
+	0x28c000b6: 446, // lb-LU
+	0x29a00000: 447, // lg
+	0x29a00130: 448, // lg-UG
+	0x2a600000: 449, // lkt
+	0x2a600134: 450, // lkt-US
+	0x2ac00000: 451, // ln
+	0x2ac00029: 452, // ln-AO
+	0x2ac0004a: 453, // ln-CD
+	0x2ac0004b: 454, // ln-CF
+	0x2ac0004c: 455, // ln-CG
+	0x2af00000: 456, // lo
+	0x2af000ae: 457, // lo-LA
+	0x2b600000: 458, // lrc
+	0x2b60009a: 459, // lrc-IQ
+	0x2b60009b: 460, // lrc-IR
+	0x2b700000: 461, // lt
+	0x2b7000b5: 462, // lt-LT
+	0x2b900000: 463, // lu
+	0x2b90004a: 464, // lu-CD
+	0x2bb00000: 465, // luo
+	0x2bb000a3: 466, // luo-KE
+	0x2bc00000: 467, // luy
+	0x2bc000a3: 468, // luy-KE
+	0x2be00000: 469, // lv
+	0x2be000b7: 470, // lv-LV
+	0x2c800000: 471, // mas
+	0x2c8000a3: 472, // mas-KE
+	0x2c80012e: 473, // mas-TZ
+	0x2e000000: 474, // mer
+	0x2e0000a3: 475, // mer-KE
+	0x2e400000: 476, // mfe
+	0x2e4000cb: 477, // mfe-MU
+	0x2e800000: 478, // mg
+	0x2e8000be: 479, // mg-MG
+	0x2e900000: 480, // mgh
+	0x2e9000d0: 481, // mgh-MZ
+	0x2eb00000: 482, // mgo
+	0x2eb00051: 483, // mgo-CM
+	0x2f600000: 484, // mk
+	0x2f6000c1: 485, // mk-MK
+	0x2fb00000: 486, // ml
+	0x2fb00098: 487, // ml-IN
+	0x30200000: 488, // mn
+	0x302000c4: 489, // mn-MN
+	0x31200000: 490, // mr
+	0x31200098: 491, // mr-IN
+	0x31600000: 492, // ms
+	0x3160003d: 493, // ms-BN
+	0x316000cf: 494, // ms-MY
+	0x3160010c: 495, // ms-SG
+	0x31700000: 496, // mt
+	0x317000ca: 497, // mt-MT
+	0x31c00000: 498, // mua
+	0x31c00051: 499, // mua-CM
+	0x32800000: 500, // my
+	0x328000c3: 501, // my-MM
+	0x33100000: 502, // mzn
+	0x3310009b: 503, // mzn-IR
+	0x33800000: 504, // nah
+	0x33c00000: 505, // naq
+	0x33c000d1: 506, // naq-NA
+	0x33e00000: 507, // nb
+	0x33e000d9: 508, // nb-NO
+	0x33e0010f: 509, // nb-SJ
+	0x34500000: 510, // nd
+	0x34500163: 511, // nd-ZW
+	0x34700000: 512, // nds
+	0x3470005f: 513, // nds-DE
+	0x347000d8: 514, // nds-NL
+	0x34800000: 515, // ne
+	0x34800098: 516, // ne-IN
+	0x348000da: 517, // ne-NP
+	0x35e00000: 518, // nl
+	0x35e0002f: 519, // nl-AW
+	0x35e00035: 520, // nl-BE
+	0x35e0003f: 521, // nl-BQ
+	0x35e0005a: 522, // nl-CW
+	0x35e000d8: 523, // nl-NL
+	0x35e00115: 524, // nl-SR
+	0x35e0011a: 525, // nl-SX
+	0x35f00000: 526, // nmg
+	0x35f00051: 527, // nmg-CM
+	0x36100000: 528, // nn
+	0x361000d9: 529, // nn-NO
+	0x36300000: 530, // nnh
+	0x36300051: 531, // nnh-CM
+	0x36600000: 532, // no
+	0x36c00000: 533, // nqo
+	0x36d00000: 534, // nr
+	0x37100000: 535, // nso
+	0x37700000: 536, // nus
+	0x37700116: 537, // nus-SS
+	0x37e00000: 538, // ny
+	0x38000000: 539, // nyn
+	0x38000130: 540, // nyn-UG
+	0x38700000: 541, // om
+	0x3870006e: 542, // om-ET
+	0x387000a3: 543, // om-KE
+	0x38c00000: 544, // or
+	0x38c00098: 545, // or-IN
+	0x38f00000: 546, // os
+	0x38f0007c: 547, // os-GE
+	0x38f00105: 548, // os-RU
+	0x39400000: 549, // pa
+	0x39405000: 550, // pa-Arab
+	0x394050e7: 551, // pa-Arab-PK
+	0x3942f000: 552, // pa-Guru
+	0x3942f098: 553, // pa-Guru-IN
+	0x39800000: 554, // pap
+	0x3aa00000: 555, // pl
+	0x3aa000e8: 556, // pl-PL
+	0x3b400000: 557, // prg
+	0x3b400001: 558, // prg-001
+	0x3b500000: 559, // ps
+	0x3b500023: 560, // ps-AF
+	0x3b700000: 561, // pt
+	0x3b700029: 562, // pt-AO
+	0x3b700040: 563, // pt-BR
+	0x3b70004d: 564, // pt-CH
+	0x3b700059: 565, // pt-CV
+	0x3b700085: 566, // pt-GQ
+	0x3b70008a: 567, // pt-GW
+	0x3b7000b6: 568, // pt-LU
+	0x3b7000c5: 569, // pt-MO
+	0x3b7000d0: 570, // pt-MZ
+	0x3b7000ed: 571, // pt-PT
+	0x3b700117: 572, // pt-ST
+	0x3b700125: 573, // pt-TL
+	0x3bb00000: 574, // qu
+	0x3bb0003e: 575, // qu-BO
+	0x3bb00068: 576, // qu-EC
+	0x3bb000e3: 577, // qu-PE
+	0x3cb00000: 578, // rm
+	0x3cb0004d: 579, // rm-CH
+	0x3d000000: 580, // rn
+	0x3d000039: 581, // rn-BI
+	0x3d300000: 582, // ro
+	0x3d3000bb: 583, // ro-MD
+	0x3d300103: 584, // ro-RO
+	0x3d500000: 585, // rof
+	0x3d50012e: 586, // rof-TZ
+	0x3d900000: 587, // ru
+	0x3d900046: 588, // ru-BY
+	0x3d9000a4: 589, // ru-KG
+	0x3d9000ad: 590, // ru-KZ
+	0x3d9000bb: 591, // ru-MD
+	0x3d900105: 592, // ru-RU
+	0x3d90012f: 593, // ru-UA
+	0x3dc00000: 594, // rw
+	0x3dc00106: 595, // rw-RW
+	0x3dd00000: 596, // rwk
+	0x3dd0012e: 597, // rwk-TZ
+	0x3e200000: 598, // sah
+	0x3e200105: 599, // sah-RU
+	0x3e300000: 600, // saq
+	0x3e3000a3: 601, // saq-KE
+	0x3e900000: 602, // sbp
+	0x3e90012e: 603, // sbp-TZ
+	0x3f200000: 604, // sdh
+	0x3f300000: 605, // se
+	0x3f300071: 606, // se-FI
+	0x3f3000d9: 607, // se-NO
+	0x3f30010b: 608, // se-SE
+	0x3f500000: 609, // seh
+	0x3f5000d0: 610, // seh-MZ
+	0x3f700000: 611, // ses
+	0x3f7000c2: 612, // ses-ML
+	0x3f800000: 613, // sg
+	0x3f80004b: 614, // sg-CF
+	0x3fe00000: 615, // shi
+	0x3fe52000: 616, // shi-Latn
+	0x3fe520b9: 617, // shi-Latn-MA
+	0x3fed2000: 618, // shi-Tfng
+	0x3fed20b9: 619, // shi-Tfng-MA
+	0x40200000: 620, // si
+	0x402000b2: 621, // si-LK
+	0x40800000: 622, // sk
+	0x40800110: 623, // sk-SK
+	0x40c00000: 624, // sl
+	0x40c0010e: 625, // sl-SI
+	0x41200000: 626, // sma
+	0x41300000: 627, // smi
+	0x41400000: 628, // smj
+	0x41500000: 629, // smn
+	0x41500071: 630, // smn-FI
+	0x41800000: 631, // sms
+	0x41900000: 632, // sn
+	0x41900163: 633, // sn-ZW
+	0x41f00000: 634, // so
+	0x41f00061: 635, // so-DJ
+	0x41f0006e: 636, // so-ET
+	0x41f000a3: 637, // so-KE
+	0x41f00114: 638, // so-SO
+	0x42700000: 639, // sq
+	0x42700026: 640, // sq-AL
+	0x427000c1: 641, // sq-MK
+	0x4270014c: 642, // sq-XK
+	0x42800000: 643, // sr
+	0x4281e000: 644, // sr-Cyrl
+	0x4281e032: 645, // sr-Cyrl-BA
+	0x4281e0bc: 646, // sr-Cyrl-ME
+	0x4281e104: 647, // sr-Cyrl-RS
+	0x4281e14c: 648, // sr-Cyrl-XK
+	0x42852000: 649, // sr-Latn
+	0x42852032: 650, // sr-Latn-BA
+	0x428520bc: 651, // sr-Latn-ME
+	0x42852104: 652, // sr-Latn-RS
+	0x4285214c: 653, // sr-Latn-XK
+	0x42d00000: 654, // ss
+	0x43000000: 655, // ssy
+	0x43100000: 656, // st
+	0x43a00000: 657, // sv
+	0x43a00030: 658, // sv-AX
+	0x43a00071: 659, // sv-FI
+	0x43a0010b: 660, // sv-SE
+	0x43b00000: 661, // sw
+	0x43b0004a: 662, // sw-CD
+	0x43b000a3: 663, // sw-KE
+	0x43b0012e: 664, // sw-TZ
+	0x43b00130: 665, // sw-UG
+	0x44400000: 666, // syr
+	0x44600000: 667, // ta
+	0x44600098: 668, // ta-IN
+	0x446000b2: 669, // ta-LK
+	0x446000cf: 670, // ta-MY
+	0x4460010c: 671, // ta-SG
+	0x45700000: 672, // te
+	0x45700098: 673, // te-IN
+	0x45a00000: 674, // teo
+	0x45a000a3: 675, // teo-KE
+	0x45a00130: 676, // teo-UG
+	0x46100000: 677, // th
+	0x46100122: 678, // th-TH
+	0x46500000: 679, // ti
+	0x4650006c: 680, // ti-ER
+	0x4650006e: 681, // ti-ET
+	0x46700000: 682, // tig
+	0x46c00000: 683, // tk
+	0x46c00126: 684, // tk-TM
+	0x47600000: 685, // tn
+	0x47800000: 686, // to
+	0x47800128: 687, // to-TO
+	0x48000000: 688, // tr
+	0x4800005c: 689, // tr-CY
+	0x4800012a: 690, // tr-TR
+	0x48400000: 691, // ts
+	0x49a00000: 692, // twq
+	0x49a000d3: 693, // twq-NE
+	0x49f00000: 694, // tzm
+	0x49f000b9: 695, // tzm-MA
+	0x4a200000: 696, // ug
+	0x4a200052: 697, // ug-CN
+	0x4a400000: 698, // uk
+	0x4a40012f: 699, // uk-UA
+	0x4aa00000: 700, // ur
+	0x4aa00098: 701, // ur-IN
+	0x4aa000e7: 702, // ur-PK
+	0x4b200000: 703, // uz
+	0x4b205000: 704, // uz-Arab
+	0x4b205023: 705, // uz-Arab-AF
+	0x4b21e000: 706, // uz-Cyrl
+	0x4b21e136: 707, // uz-Cyrl-UZ
+	0x4b252000: 708, // uz-Latn
+	0x4b252136: 709, // uz-Latn-UZ
+	0x4b400000: 710, // vai
+	0x4b452000: 711, // vai-Latn
+	0x4b4520b3: 712, // vai-Latn-LR
+	0x4b4d9000: 713, // vai-Vaii
+	0x4b4d90b3: 714, // vai-Vaii-LR
+	0x4b600000: 715, // ve
+	0x4b900000: 716, // vi
+	0x4b90013d: 717, // vi-VN
+	0x4bf00000: 718, // vo
+	0x4bf00001: 719, // vo-001
+	0x4c200000: 720, // vun
+	0x4c20012e: 721, // vun-TZ
+	0x4c400000: 722, // wa
+	0x4c500000: 723, // wae
+	0x4c50004d: 724, // wae-CH
+	0x4db00000: 725, // wo
+	0x4e800000: 726, // xh
+	0x4f100000: 727, // xog
+	0x4f100130: 728, // xog-UG
+	0x4ff00000: 729, // yav
+	0x4ff00051: 730, // yav-CM
+	0x50800000: 731, // yi
+	0x50800001: 732, // yi-001
+	0x50e00000: 733, // yo
+	0x50e0003a: 734, // yo-BJ
+	0x50e000d5: 735, // yo-NG
+	0x51500000: 736, // yue
+	0x5150008c: 737, // yue-HK
+	0x51e00000: 738, // zgh
+	0x51e000b9: 739, // zgh-MA
+	0x51f00000: 740, // zh
+	0x51f34000: 741, // zh-Hans
+	0x51f34052: 742, // zh-Hans-CN
+	0x51f3408c: 743, // zh-Hans-HK
+	0x51f340c5: 744, // zh-Hans-MO
+	0x51f3410c: 745, // zh-Hans-SG
+	0x51f35000: 746, // zh-Hant
+	0x51f3508c: 747, // zh-Hant-HK
+	0x51f350c5: 748, // zh-Hant-MO
+	0x51f3512d: 749, // zh-Hant-TW
+	0x52400000: 750, // zu
+	0x52400160: 751, // zu-ZA
+}
+
+// Total table size 4580 bytes (4KiB); checksum: A7F72A2A
diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go
new file mode 100644
index 000000000..5eecceb61
--- /dev/null
+++ b/vendor/golang.org/x/text/language/language.go
@@ -0,0 +1,975 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run maketables.go gen_common.go -output tables.go
+//go:generate go run gen_index.go
+
+// Package language implements BCP 47 language tags and related functionality.
+//
+// The Tag type, which is used to represent languages, is agnostic to the
+// meaning of its subtags. Tags are not fully canonicalized to preserve
+// information that may be valuable in certain contexts. As a consequence, two
+// different tags may represent identical languages.
+//
+// Initializing language- or locale-specific components usually consists of
+// two steps. The first step is to select a display language based on the
+// preferred languages of the user and the languages supported by an application.
+// The second step is to create the language-specific services based on
+// this selection. Each is discussed in more details below.
+//
+// Matching preferred against supported languages
+//
+// An application may support various languages. This list is typically limited
+// by the languages for which there exists translations of the user interface.
+// Similarly, a user may provide a list of preferred languages which is limited
+// by the languages understood by this user.
+// An application should use a Matcher to find the best supported language based
+// on the user's preferred list.
+// Matchers are aware of the intricacies of equivalence between languages.
+// The default Matcher implementation takes into account things such as
+// deprecated subtags, legacy tags, and mutual intelligibility between scripts
+// and languages.
+//
+// A Matcher for English, Australian English, Danish, and standard Mandarin can
+// be defined as follows:
+//
+//		var matcher = language.NewMatcher([]language.Tag{
+//			language.English,   // The first language is used as fallback.
+// 			language.MustParse("en-AU"),
+//			language.Danish,
+//			language.Chinese,
+//		})
+//
+// The following code selects the best match for someone speaking Spanish and
+// Norwegian:
+//
+// 		preferred := []language.Tag{ language.Spanish, language.Norwegian }
+//		tag, _, _ := matcher.Match(preferred...)
+//
+// In this case, the best match is Danish, as Danish is sufficiently a match to
+// Norwegian to not have to fall back to the default.
+// See ParseAcceptLanguage on how to handle the Accept-Language HTTP header.
+//
+// Selecting language-specific services
+//
+// One should always use the Tag returned by the Matcher to create an instance
+// of any of the language-specific services provided by the text repository.
+// This prevents the mixing of languages, such as having a different language for
+// messages and display names, as well as improper casing or sorting order for
+// the selected language.
+// Using the returned Tag also allows user-defined settings, such as collation
+// order or numbering system to be transparently passed as options.
+//
+// If you have language-specific data in your application, however, it will in
+// most cases suffice to use the index returned by the matcher to identify
+// the user language.
+// The following loop provides an alternative in case this is not sufficient:
+//
+// 		supported := map[language.Tag]data{
+//			language.English:            enData,
+// 			language.MustParse("en-AU"): enAUData,
+//			language.Danish:             daData,
+//			language.Chinese:            zhData,
+// 		}
+//		tag, _, _ := matcher.Match(preferred...)
+//		for ; tag != language.Und; tag = tag.Parent() {
+//			if v, ok := supported[tag]; ok {
+//				return v
+//			}
+//		}
+// 		return enData // should not reach here
+//
+// Repeatedly taking the Parent of the tag returned by Match will eventually
+// match one of the tags used to initialize the Matcher.
+//
+// Canonicalization
+//
+// By default, only legacy and deprecated tags are converted into their
+// canonical equivalent. All other information is preserved. This approach makes
+// the confidence scores more accurate and allows matchers to distinguish
+// between variants that are otherwise lost.
+//
+// As a consequence, two tags that should be treated as identical according to
+// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The
+// Matchers will handle such distinctions, though, and are aware of the
+// equivalence relations. The CanonType type can be used to alter the
+// canonicalization form.
+//
+// References
+//
+// BCP 47 - Tags for Identifying Languages
+// http://tools.ietf.org/html/bcp47
+package language // import "golang.org/x/text/language"
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+	"errors"
+	"fmt"
+	"strings"
+)
+
+const (
+	// maxCoreSize is the maximum size of a BCP 47 tag without variants and
+	// extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
+	maxCoreSize = 12
+
+	// max99thPercentileSize is a somewhat arbitrary buffer size that presumably
+	// is large enough to hold at least 99% of the BCP 47 tags.
+	max99thPercentileSize = 32
+
+	// maxSimpleUExtensionSize is the maximum size of a -u extension with one
+	// key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
+	maxSimpleUExtensionSize = 14
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed.
+type Tag struct {
+	lang     langID
+	region   regionID
+	script   scriptID
+	pVariant byte   // offset in str, includes preceding '-'
+	pExt     uint16 // offset of first extension, includes preceding '-'
+
+	// str is the string representation of the Tag. It will only be used if the
+	// tag has variants or extensions.
+	str string
+}
+
+// Make is a convenience wrapper for Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func Make(s string) Tag {
+	return Default.Make(s)
+}
+
+// Make is a convenience wrapper for c.Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func (c CanonType) Make(s string) Tag {
+	t, _ := c.Parse(s)
+	return t
+}
+
+// Raw returns the raw base language, script and region, without making an
+// attempt to infer their values.
+func (t Tag) Raw() (b Base, s Script, r Region) {
+	return Base{t.lang}, Script{t.script}, Region{t.region}
+}
+
+// equalTags compares language, script and region subtags only.
+func (t Tag) equalTags(a Tag) bool {
+	return t.lang == a.lang && t.script == a.script && t.region == a.region
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+	if int(t.pVariant) < len(t.str) {
+		return false
+	}
+	return t.equalTags(und)
+}
+
+// private reports whether the Tag consists solely of a private use tag.
+func (t Tag) private() bool {
+	return t.str != "" && t.pVariant == 0
+}
+
+// CanonType can be used to enable or disable various types of canonicalization.
+type CanonType int
+
+const (
+	// Replace deprecated base languages with their preferred replacements.
+	DeprecatedBase CanonType = 1 << iota
+	// Replace deprecated scripts with their preferred replacements.
+	DeprecatedScript
+	// Replace deprecated regions with their preferred replacements.
+	DeprecatedRegion
+	// Remove redundant scripts.
+	SuppressScript
+	// Normalize legacy encodings. This includes legacy languages defined in
+	// CLDR as well as bibliographic codes defined in ISO-639.
+	Legacy
+	// Map the dominant language of a macro language group to the macro language
+	// subtag. For example cmn -> zh.
+	Macro
+	// The CLDR flag should be used if full compatibility with CLDR is required.
+	// There are a few cases where language.Tag may differ from CLDR. To follow all
+	// of CLDR's suggestions, use All|CLDR.
+	CLDR
+
+	// Raw can be used to Compose or Parse without Canonicalization.
+	Raw CanonType = 0
+
+	// Replace all deprecated tags with their preferred replacements.
+	Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion
+
+	// All canonicalizations recommended by BCP 47.
+	BCP47 = Deprecated | SuppressScript
+
+	// All canonicalizations.
+	All = BCP47 | Legacy | Macro
+
+	// Default is the canonicalization used by Parse, Make and Compose. To
+	// preserve as much information as possible, canonicalizations that remove
+	// potentially valuable information are not included. The Matcher is
+	// designed to recognize similar tags that would be the same if
+	// they were canonicalized using All.
+	Default = Deprecated | Legacy
+
+	canonLang = DeprecatedBase | Legacy | Macro
+
+	// TODO: LikelyScript, LikelyRegion: suppress similar to ICU.
+)
+
+// canonicalize returns the canonicalized equivalent of the tag and
+// whether there was any change.
+func (t Tag) canonicalize(c CanonType) (Tag, bool) {
+	if c == Raw {
+		return t, false
+	}
+	changed := false
+	if c&SuppressScript != 0 {
+		if t.lang < langNoIndexOffset && uint8(t.script) == suppressScript[t.lang] {
+			t.script = 0
+			changed = true
+		}
+	}
+	if c&canonLang != 0 {
+		for {
+			if l, aliasType := normLang(t.lang); l != t.lang {
+				switch aliasType {
+				case langLegacy:
+					if c&Legacy != 0 {
+						if t.lang == _sh && t.script == 0 {
+							t.script = _Latn
+						}
+						t.lang = l
+						changed = true
+					}
+				case langMacro:
+					if c&Macro != 0 {
+						// We deviate here from CLDR. The mapping "nb" -> "no"
+						// qualifies as a typical Macro language mapping.  However,
+						// for legacy reasons, CLDR maps "no", the macro language
+						// code for Norwegian, to the dominant variant "nb". This
+						// change is currently under consideration for CLDR as well.
+						// See http://unicode.org/cldr/trac/ticket/2698 and also
+						// http://unicode.org/cldr/trac/ticket/1790 for some of the
+						// practical implications. TODO: this check could be removed
+						// if CLDR adopts this change.
+						if c&CLDR == 0 || t.lang != _nb {
+							changed = true
+							t.lang = l
+						}
+					}
+				case langDeprecated:
+					if c&DeprecatedBase != 0 {
+						if t.lang == _mo && t.region == 0 {
+							t.region = _MD
+						}
+						t.lang = l
+						changed = true
+						// Other canonicalization types may still apply.
+						continue
+					}
+				}
+			} else if c&Legacy != 0 && t.lang == _no && c&CLDR != 0 {
+				t.lang = _nb
+				changed = true
+			}
+			break
+		}
+	}
+	if c&DeprecatedScript != 0 {
+		if t.script == _Qaai {
+			changed = true
+			t.script = _Zinh
+		}
+	}
+	if c&DeprecatedRegion != 0 {
+		if r := normRegion(t.region); r != 0 {
+			changed = true
+			t.region = r
+		}
+	}
+	return t, changed
+}
+
+// Canonicalize returns the canonicalized equivalent of the tag.
+func (c CanonType) Canonicalize(t Tag) (Tag, error) {
+	t, changed := t.canonicalize(c)
+	if changed {
+		t.remakeString()
+	}
+	return t, nil
+}
+
+// Confidence indicates the level of certainty for a given return value.
+// For example, Serbian may be written in Cyrillic or Latin script.
+// The confidence level indicates whether a value was explicitly specified,
+// whether it is typically the only possible value, or whether there is
+// an ambiguity.
+type Confidence int
+
+const (
+	No    Confidence = iota // full confidence that there was no match
+	Low                     // most likely value picked out of a set of alternatives
+	High                    // value is generally assumed to be the correct match
+	Exact                   // exact match or explicitly specified value
+)
+
+var confName = []string{"No", "Low", "High", "Exact"}
+
+func (c Confidence) String() string {
+	return confName[c]
+}
+
+// remakeString is used to update t.str in case lang, script or region changed.
+// It is assumed that pExt and pVariant still point to the start of the
+// respective parts.
+func (t *Tag) remakeString() {
+	if t.str == "" {
+		return
+	}
+	extra := t.str[t.pVariant:]
+	if t.pVariant > 0 {
+		extra = extra[1:]
+	}
+	if t.equalTags(und) && strings.HasPrefix(extra, "x-") {
+		t.str = extra
+		t.pVariant = 0
+		t.pExt = 0
+		return
+	}
+	var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
+	b := buf[:t.genCoreBytes(buf[:])]
+	if extra != "" {
+		diff := len(b) - int(t.pVariant)
+		b = append(b, '-')
+		b = append(b, extra...)
+		t.pVariant = uint8(int(t.pVariant) + diff)
+		t.pExt = uint16(int(t.pExt) + diff)
+	} else {
+		t.pVariant = uint8(len(b))
+		t.pExt = uint16(len(b))
+	}
+	t.str = string(b)
+}
+
+// genCoreBytes writes a string for the base languages, script and region tags
+// to the given buffer and returns the number of bytes written. It will never
+// write more than maxCoreSize bytes.
+func (t *Tag) genCoreBytes(buf []byte) int {
+	n := t.lang.stringToBuf(buf[:])
+	if t.script != 0 {
+		n += copy(buf[n:], "-")
+		n += copy(buf[n:], t.script.String())
+	}
+	if t.region != 0 {
+		n += copy(buf[n:], "-")
+		n += copy(buf[n:], t.region.String())
+	}
+	return n
+}
+
+// String returns the canonical string representation of the language tag.
+func (t Tag) String() string {
+	if t.str != "" {
+		return t.str
+	}
+	if t.script == 0 && t.region == 0 {
+		return t.lang.String()
+	}
+	buf := [maxCoreSize]byte{}
+	return string(buf[:t.genCoreBytes(buf[:])])
+}
+
+// Base returns the base language of the language tag. If the base language is
+// unspecified, an attempt will be made to infer it from the context.
+// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
+func (t Tag) Base() (Base, Confidence) {
+	if t.lang != 0 {
+		return Base{t.lang}, Exact
+	}
+	c := High
+	if t.script == 0 && !(Region{t.region}).IsCountry() {
+		c = Low
+	}
+	if tag, err := addTags(t); err == nil && tag.lang != 0 {
+		return Base{tag.lang}, c
+	}
+	return Base{0}, No
+}
+
+// Script infers the script for the language tag. If it was not explicitly given, it will infer
+// a most likely candidate.
+// If more than one script is commonly used for a language, the most likely one
+// is returned with a low confidence indication. For example, it returns (Cyrl, Low)
+// for Serbian.
+// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined)
+// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks
+// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts.
+// See http://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for
+// unknown value in CLDR.  (Zzzz, Exact) is returned if Zzzz was explicitly specified.
+// Note that an inferred script is never guaranteed to be the correct one. Latin is
+// almost exclusively used for Afrikaans, but Arabic has been used for some texts
+// in the past.  Also, the script that is commonly used may change over time.
+// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
+func (t Tag) Script() (Script, Confidence) {
+	if t.script != 0 {
+		return Script{t.script}, Exact
+	}
+	sc, c := scriptID(_Zzzz), No
+	if t.lang < langNoIndexOffset {
+		if scr := scriptID(suppressScript[t.lang]); scr != 0 {
+			// Note: it is not always the case that a language with a suppress
+			// script value is only written in one script (e.g. kk, ms, pa).
+			if t.region == 0 {
+				return Script{scriptID(scr)}, High
+			}
+			sc, c = scr, High
+		}
+	}
+	if tag, err := addTags(t); err == nil {
+		if tag.script != sc {
+			sc, c = tag.script, Low
+		}
+	} else {
+		t, _ = (Deprecated | Macro).Canonicalize(t)
+		if tag, err := addTags(t); err == nil && tag.script != sc {
+			sc, c = tag.script, Low
+		}
+	}
+	return Script{sc}, c
+}
+
+// Region returns the region for the language tag. If it was not explicitly given, it will
+// infer a most likely candidate from the context.
+// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
+func (t Tag) Region() (Region, Confidence) {
+	if t.region != 0 {
+		return Region{t.region}, Exact
+	}
+	if t, err := addTags(t); err == nil {
+		return Region{t.region}, Low // TODO: differentiate between high and low.
+	}
+	t, _ = (Deprecated | Macro).Canonicalize(t)
+	if tag, err := addTags(t); err == nil {
+		return Region{tag.region}, Low
+	}
+	return Region{_ZZ}, No // TODO: return world instead of undetermined?
+}
+
+// Variant returns the variants specified explicitly for this language tag.
+// or nil if no variant was specified.
+func (t Tag) Variants() []Variant {
+	v := []Variant{}
+	if int(t.pVariant) < int(t.pExt) {
+		for x, str := "", t.str[t.pVariant:t.pExt]; str != ""; {
+			x, str = nextToken(str)
+			v = append(v, Variant{x})
+		}
+	}
+	return v
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+	if t.str != "" {
+		// Strip the variants and extensions.
+		t, _ = Raw.Compose(t.Raw())
+		if t.region == 0 && t.script != 0 && t.lang != 0 {
+			base, _ := addTags(Tag{lang: t.lang})
+			if base.script == t.script {
+				return Tag{lang: t.lang}
+			}
+		}
+		return t
+	}
+	if t.lang != 0 {
+		if t.region != 0 {
+			maxScript := t.script
+			if maxScript == 0 {
+				max, _ := addTags(t)
+				maxScript = max.script
+			}
+
+			for i := range parents {
+				if langID(parents[i].lang) == t.lang && scriptID(parents[i].maxScript) == maxScript {
+					for _, r := range parents[i].fromRegion {
+						if regionID(r) == t.region {
+							return Tag{
+								lang:   t.lang,
+								script: scriptID(parents[i].script),
+								region: regionID(parents[i].toRegion),
+							}
+						}
+					}
+				}
+			}
+
+			// Strip the script if it is the default one.
+			base, _ := addTags(Tag{lang: t.lang})
+			if base.script != maxScript {
+				return Tag{lang: t.lang, script: maxScript}
+			}
+			return Tag{lang: t.lang}
+		} else if t.script != 0 {
+			// The parent for an base-script pair with a non-default script is
+			// "und" instead of the base language.
+			base, _ := addTags(Tag{lang: t.lang})
+			if base.script != t.script {
+				return und
+			}
+			return Tag{lang: t.lang}
+		}
+	}
+	return und
+}
+
+// returns token t and the rest of the string.
+func nextToken(s string) (t, tail string) {
+	p := strings.Index(s[1:], "-")
+	if p == -1 {
+		return s[1:], ""
+	}
+	p++
+	return s[1:p], s[p:]
+}
+
+// Extension is a single BCP 47 extension.
+type Extension struct {
+	s string
+}
+
+// String returns the string representation of the extension, including the
+// type tag.
+func (e Extension) String() string {
+	return e.s
+}
+
+// ParseExtension parses s as an extension and returns it on success.
+func ParseExtension(s string) (e Extension, err error) {
+	scan := makeScannerString(s)
+	var end int
+	if n := len(scan.token); n != 1 {
+		return Extension{}, errSyntax
+	}
+	scan.toLower(0, len(scan.b))
+	end = parseExtension(&scan)
+	if end != len(s) {
+		return Extension{}, errSyntax
+	}
+	return Extension{string(scan.b)}, nil
+}
+
+// Type returns the one-byte extension type of e. It returns 0 for the zero
+// exception.
+func (e Extension) Type() byte {
+	if e.s == "" {
+		return 0
+	}
+	return e.s[0]
+}
+
+// Tokens returns the list of tokens of e.
+func (e Extension) Tokens() []string {
+	return strings.Split(e.s, "-")
+}
+
+// Extension returns the extension of type x for tag t. It will return
+// false for ok if t does not have the requested extension. The returned
+// extension will be invalid in this case.
+func (t Tag) Extension(x byte) (ext Extension, ok bool) {
+	for i := int(t.pExt); i < len(t.str)-1; {
+		var ext string
+		i, ext = getExtension(t.str, i)
+		if ext[0] == x {
+			return Extension{ext}, true
+		}
+	}
+	return Extension{}, false
+}
+
+// Extensions returns all extensions of t.
+func (t Tag) Extensions() []Extension {
+	e := []Extension{}
+	for i := int(t.pExt); i < len(t.str)-1; {
+		var ext string
+		i, ext = getExtension(t.str, i)
+		e = append(e, Extension{ext})
+	}
+	return e
+}
+
+// TypeForKey returns the type associated with the given key, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// TypeForKey will traverse the inheritance chain to get the correct value.
+func (t Tag) TypeForKey(key string) string {
+	if start, end, _ := t.findTypeForKey(key); end != start {
+		return t.str[start:end]
+	}
+	return ""
+}
+
+var (
+	errPrivateUse       = errors.New("cannot set a key on a private use tag")
+	errInvalidArguments = errors.New("invalid key or type")
+)
+
+// SetTypeForKey returns a new Tag with the key set to type, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// An empty value removes an existing pair with the same key.
+func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
+	if t.private() {
+		return t, errPrivateUse
+	}
+	if len(key) != 2 {
+		return t, errInvalidArguments
+	}
+
+	// Remove the setting if value is "".
+	if value == "" {
+		start, end, _ := t.findTypeForKey(key)
+		if start != end {
+			// Remove key tag and leading '-'.
+			start -= 4
+
+			// Remove a possible empty extension.
+			if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' {
+				start -= 2
+			}
+			if start == int(t.pVariant) && end == len(t.str) {
+				t.str = ""
+				t.pVariant, t.pExt = 0, 0
+			} else {
+				t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
+			}
+		}
+		return t, nil
+	}
+
+	if len(value) < 3 || len(value) > 8 {
+		return t, errInvalidArguments
+	}
+
+	var (
+		buf    [maxCoreSize + maxSimpleUExtensionSize]byte
+		uStart int // start of the -u extension.
+	)
+
+	// Generate the tag string if needed.
+	if t.str == "" {
+		uStart = t.genCoreBytes(buf[:])
+		buf[uStart] = '-'
+		uStart++
+	}
+
+	// Create new key-type pair and parse it to verify.
+	b := buf[uStart:]
+	copy(b, "u-")
+	copy(b[2:], key)
+	b[4] = '-'
+	b = b[:5+copy(b[5:], value)]
+	scan := makeScanner(b)
+	if parseExtensions(&scan); scan.err != nil {
+		return t, scan.err
+	}
+
+	// Assemble the replacement string.
+	if t.str == "" {
+		t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
+		t.str = string(buf[:uStart+len(b)])
+	} else {
+		s := t.str
+		start, end, hasExt := t.findTypeForKey(key)
+		if start == end {
+			if hasExt {
+				b = b[2:]
+			}
+			t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:])
+		} else {
+			t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:])
+		}
+	}
+	return t, nil
+}
+
+// findKeyAndType returns the start and end position for the type corresponding
+// to key or the point at which to insert the key-value pair if the type
+// wasn't found. The hasExt return value reports whether an -u extension was present.
+// Note: the extensions are typically very small and are likely to contain
+// only one key-type pair.
+func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) {
+	p := int(t.pExt)
+	if len(key) != 2 || p == len(t.str) || p == 0 {
+		return p, p, false
+	}
+	s := t.str
+
+	// Find the correct extension.
+	for p++; s[p] != 'u'; p++ {
+		if s[p] > 'u' {
+			p--
+			return p, p, false
+		}
+		if p = nextExtension(s, p); p == len(s) {
+			return len(s), len(s), false
+		}
+	}
+	// Proceed to the hyphen following the extension name.
+	p++
+
+	// curKey is the key currently being processed.
+	curKey := ""
+
+	// Iterate over keys until we get the end of a section.
+	for {
+		// p points to the hyphen preceding the current token.
+		if p3 := p + 3; s[p3] == '-' {
+			// Found a key.
+			// Check whether we just processed the key that was requested.
+			if curKey == key {
+				return start, p, true
+			}
+			// Set to the next key and continue scanning type tokens.
+			curKey = s[p+1 : p3]
+			if curKey > key {
+				return p, p, true
+			}
+			// Start of the type token sequence.
+			start = p + 4
+			// A type is at least 3 characters long.
+			p += 7 // 4 + 3
+		} else {
+			// Attribute or type, which is at least 3 characters long.
+			p += 4
+		}
+		// p points past the third character of a type or attribute.
+		max := p + 5 // maximum length of token plus hyphen.
+		if len(s) < max {
+			max = len(s)
+		}
+		for ; p < max && s[p] != '-'; p++ {
+		}
+		// Bail if we have exhausted all tokens or if the next token starts
+		// a new extension.
+		if p == len(s) || s[p+2] == '-' {
+			if curKey == key {
+				return start, p, true
+			}
+			return p, p, true
+		}
+	}
+}
+
+// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags
+// for which data exists in the text repository. The index will change over time
+// and should not be stored in persistent storage. Extensions, except for the
+// 'va' type of the 'u' extension, are ignored. It will return 0, false if no
+// compact tag exists, where 0 is the index for the root language (Und).
+func CompactIndex(t Tag) (index int, ok bool) {
+	// TODO: perhaps give more frequent tags a lower index.
+	// TODO: we could make the indexes stable. This will excluded some
+	//       possibilities for optimization, so don't do this quite yet.
+	b, s, r := t.Raw()
+	if len(t.str) > 0 {
+		if strings.HasPrefix(t.str, "x-") {
+			// We have no entries for user-defined tags.
+			return 0, false
+		}
+		if uint16(t.pVariant) != t.pExt {
+			// There are no tags with variants and an u-va type.
+			if t.TypeForKey("va") != "" {
+				return 0, false
+			}
+			t, _ = Raw.Compose(b, s, r, t.Variants())
+		} else if _, ok := t.Extension('u'); ok {
+			// Strip all but the 'va' entry.
+			variant := t.TypeForKey("va")
+			t, _ = Raw.Compose(b, s, r)
+			t, _ = t.SetTypeForKey("va", variant)
+		}
+		if len(t.str) > 0 {
+			// We have some variants.
+			for i, s := range specialTags {
+				if s == t {
+					return i + 1, true
+				}
+			}
+			return 0, false
+		}
+	}
+	// No variants specified: just compare core components.
+	// The key has the form lllssrrr, where l, s, and r are nibbles for
+	// respectively the langID, scriptID, and regionID.
+	key := uint32(b.langID) << (8 + 12)
+	key |= uint32(s.scriptID) << 12
+	key |= uint32(r.regionID)
+	x, ok := coreTags[key]
+	return int(x), ok
+}
+
+// Base is an ISO 639 language code, used for encoding the base language
+// of a language tag.
+type Base struct {
+	langID
+}
+
+// ParseBase parses a 2- or 3-letter ISO 639 code.
+// It returns a ValueError if s is a well-formed but unknown language identifier
+// or another error if another error occurred.
+func ParseBase(s string) (Base, error) {
+	if n := len(s); n < 2 || 3 < n {
+		return Base{}, errSyntax
+	}
+	var buf [3]byte
+	l, err := getLangID(buf[:copy(buf[:], s)])
+	return Base{l}, err
+}
+
+// Script is a 4-letter ISO 15924 code for representing scripts.
+// It is idiomatically represented in title case.
+type Script struct {
+	scriptID
+}
+
+// ParseScript parses a 4-letter ISO 15924 code.
+// It returns a ValueError if s is a well-formed but unknown script identifier
+// or another error if another error occurred.
+func ParseScript(s string) (Script, error) {
+	if len(s) != 4 {
+		return Script{}, errSyntax
+	}
+	var buf [4]byte
+	sc, err := getScriptID(script, buf[:copy(buf[:], s)])
+	return Script{sc}, err
+}
+
+// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions.
+type Region struct {
+	regionID
+}
+
+// EncodeM49 returns the Region for the given UN M.49 code.
+// It returns an error if r is not a valid code.
+func EncodeM49(r int) (Region, error) {
+	rid, err := getRegionM49(r)
+	return Region{rid}, err
+}
+
+// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
+// It returns a ValueError if s is a well-formed but unknown region identifier
+// or another error if another error occurred.
+func ParseRegion(s string) (Region, error) {
+	if n := len(s); n < 2 || 3 < n {
+		return Region{}, errSyntax
+	}
+	var buf [3]byte
+	r, err := getRegionID(buf[:copy(buf[:], s)])
+	return Region{r}, err
+}
+
+// IsCountry returns whether this region is a country or autonomous area. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsCountry() bool {
+	if r.regionID == 0 || r.IsGroup() || r.IsPrivateUse() && r.regionID != _XK {
+		return false
+	}
+	return true
+}
+
+// IsGroup returns whether this region defines a collection of regions. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsGroup() bool {
+	if r.regionID == 0 {
+		return false
+	}
+	return int(regionInclusion[r.regionID]) < len(regionContainment)
+}
+
+// Contains returns whether Region c is contained by Region r. It returns true
+// if c == r.
+func (r Region) Contains(c Region) bool {
+	return r.regionID.contains(c.regionID)
+}
+
+func (r regionID) contains(c regionID) bool {
+	if r == c {
+		return true
+	}
+	g := regionInclusion[r]
+	if g >= nRegionGroups {
+		return false
+	}
+	m := regionContainment[g]
+
+	d := regionInclusion[c]
+	b := regionInclusionBits[d]
+
+	// A contained country may belong to multiple disjoint groups. Matching any
+	// of these indicates containment. If the contained region is a group, it
+	// must strictly be a subset.
+	if d >= nRegionGroups {
+		return b&m != 0
+	}
+	return b&^m == 0
+}
+
+var errNoTLD = errors.New("language: region is not a valid ccTLD")
+
+// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
+// In all other cases it returns either the region itself or an error.
+//
+// This method may return an error for a region for which there exists a
+// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
+// region will already be canonicalized it was obtained from a Tag that was
+// obtained using any of the default methods.
+func (r Region) TLD() (Region, error) {
+	// See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
+	// difference between ISO 3166-1 and IANA ccTLD.
+	if r.regionID == _GB {
+		r = Region{_UK}
+	}
+	if (r.typ() & ccTLD) == 0 {
+		return Region{}, errNoTLD
+	}
+	return r, nil
+}
+
+// Canonicalize returns the region or a possible replacement if the region is
+// deprecated. It will not return a replacement for deprecated regions that
+// are split into multiple regions.
+func (r Region) Canonicalize() Region {
+	if cr := normRegion(r.regionID); cr != 0 {
+		return Region{cr}
+	}
+	return r
+}
+
+// Variant represents a registered variant of a language as defined by BCP 47.
+type Variant struct {
+	variant string
+}
+
+// ParseVariant parses and returns a Variant. An error is returned if s is not
+// a valid variant.
+func ParseVariant(s string) (Variant, error) {
+	s = strings.ToLower(s)
+	if _, ok := variantIndex[s]; ok {
+		return Variant{s}, nil
+	}
+	return Variant{}, mkErrInvalid([]byte(s))
+}
+
+// String returns the string representation of the variant.
+func (v Variant) String() string {
+	return v.variant
+}
diff --git a/vendor/golang.org/x/text/language/lookup.go b/vendor/golang.org/x/text/language/lookup.go
new file mode 100644
index 000000000..1d80ac370
--- /dev/null
+++ b/vendor/golang.org/x/text/language/lookup.go
@@ -0,0 +1,396 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+	"bytes"
+	"fmt"
+	"sort"
+	"strconv"
+
+	"golang.org/x/text/internal/tag"
+)
+
+// findIndex tries to find the given tag in idx and returns a standardized error
+// if it could not be found.
+func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
+	if !tag.FixCase(form, key) {
+		return 0, errSyntax
+	}
+	i := idx.Index(key)
+	if i == -1 {
+		return 0, mkErrInvalid(key)
+	}
+	return i, nil
+}
+
+func searchUint(imap []uint16, key uint16) int {
+	return sort.Search(len(imap), func(i int) bool {
+		return imap[i] >= key
+	})
+}
+
+type langID uint16
+
+// getLangID returns the langID of s if s is a canonical subtag
+// or langUnknown if s is not a canonical subtag.
+func getLangID(s []byte) (langID, error) {
+	if len(s) == 2 {
+		return getLangISO2(s)
+	}
+	return getLangISO3(s)
+}
+
+// mapLang returns the mapped langID of id according to mapping m.
+func normLang(id langID) (langID, langAliasType) {
+	k := sort.Search(len(langAliasMap), func(i int) bool {
+		return langAliasMap[i].from >= uint16(id)
+	})
+	if k < len(langAliasMap) && langAliasMap[k].from == uint16(id) {
+		return langID(langAliasMap[k].to), langAliasTypes[k]
+	}
+	return id, langAliasTypeUnknown
+}
+
+// getLangISO2 returns the langID for the given 2-letter ISO language code
+// or unknownLang if this does not exist.
+func getLangISO2(s []byte) (langID, error) {
+	if !tag.FixCase("zz", s) {
+		return 0, errSyntax
+	}
+	if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
+		return langID(i), nil
+	}
+	return 0, mkErrInvalid(s)
+}
+
+const base = 'z' - 'a' + 1
+
+func strToInt(s []byte) uint {
+	v := uint(0)
+	for i := 0; i < len(s); i++ {
+		v *= base
+		v += uint(s[i] - 'a')
+	}
+	return v
+}
+
+// converts the given integer to the original ASCII string passed to strToInt.
+// len(s) must match the number of characters obtained.
+func intToStr(v uint, s []byte) {
+	for i := len(s) - 1; i >= 0; i-- {
+		s[i] = byte(v%base) + 'a'
+		v /= base
+	}
+}
+
+// getLangISO3 returns the langID for the given 3-letter ISO language code
+// or unknownLang if this does not exist.
+func getLangISO3(s []byte) (langID, error) {
+	if tag.FixCase("und", s) {
+		// first try to match canonical 3-letter entries
+		for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
+			if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] {
+				// We treat "und" as special and always translate it to "unspecified".
+				// Note that ZZ and Zzzz are private use and are not treated as
+				// unspecified by default.
+				id := langID(i)
+				if id == nonCanonicalUnd {
+					return 0, nil
+				}
+				return id, nil
+			}
+		}
+		if i := altLangISO3.Index(s); i != -1 {
+			return langID(altLangIndex[altLangISO3.Elem(i)[3]]), nil
+		}
+		n := strToInt(s)
+		if langNoIndex[n/8]&(1<<(n%8)) != 0 {
+			return langID(n) + langNoIndexOffset, nil
+		}
+		// Check for non-canonical uses of ISO3.
+		for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
+			if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
+				return langID(i), nil
+			}
+		}
+		return 0, mkErrInvalid(s)
+	}
+	return 0, errSyntax
+}
+
+// stringToBuf writes the string to b and returns the number of bytes
+// written.  cap(b) must be >= 3.
+func (id langID) stringToBuf(b []byte) int {
+	if id >= langNoIndexOffset {
+		intToStr(uint(id)-langNoIndexOffset, b[:3])
+		return 3
+	} else if id == 0 {
+		return copy(b, "und")
+	}
+	l := lang[id<<2:]
+	if l[3] == 0 {
+		return copy(b, l[:3])
+	}
+	return copy(b, l[:2])
+}
+
+// String returns the BCP 47 representation of the langID.
+// Use b as variable name, instead of id, to ensure the variable
+// used is consistent with that of Base in which this type is embedded.
+func (b langID) String() string {
+	if b == 0 {
+		return "und"
+	} else if b >= langNoIndexOffset {
+		b -= langNoIndexOffset
+		buf := [3]byte{}
+		intToStr(uint(b), buf[:])
+		return string(buf[:])
+	}
+	l := lang.Elem(int(b))
+	if l[3] == 0 {
+		return l[:3]
+	}
+	return l[:2]
+}
+
+// ISO3 returns the ISO 639-3 language code.
+func (b langID) ISO3() string {
+	if b == 0 || b >= langNoIndexOffset {
+		return b.String()
+	}
+	l := lang.Elem(int(b))
+	if l[3] == 0 {
+		return l[:3]
+	} else if l[2] == 0 {
+		return altLangISO3.Elem(int(l[3]))[:3]
+	}
+	// This allocation will only happen for 3-letter ISO codes
+	// that are non-canonical BCP 47 language identifiers.
+	return l[0:1] + l[2:4]
+}
+
+// IsPrivateUse reports whether this language code is reserved for private use.
+func (b langID) IsPrivateUse() bool {
+	return langPrivateStart <= b && b <= langPrivateEnd
+}
+
+type regionID uint16
+
+// getRegionID returns the region id for s if s is a valid 2-letter region code
+// or unknownRegion.
+func getRegionID(s []byte) (regionID, error) {
+	if len(s) == 3 {
+		if isAlpha(s[0]) {
+			return getRegionISO3(s)
+		}
+		if i, err := strconv.ParseUint(string(s), 10, 10); err == nil {
+			return getRegionM49(int(i))
+		}
+	}
+	return getRegionISO2(s)
+}
+
+// getRegionISO2 returns the regionID for the given 2-letter ISO country code
+// or unknownRegion if this does not exist.
+func getRegionISO2(s []byte) (regionID, error) {
+	i, err := findIndex(regionISO, s, "ZZ")
+	if err != nil {
+		return 0, err
+	}
+	return regionID(i) + isoRegionOffset, nil
+}
+
+// getRegionISO3 returns the regionID for the given 3-letter ISO country code
+// or unknownRegion if this does not exist.
+func getRegionISO3(s []byte) (regionID, error) {
+	if tag.FixCase("ZZZ", s) {
+		for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
+			if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
+				return regionID(i) + isoRegionOffset, nil
+			}
+		}
+		for i := 0; i < len(altRegionISO3); i += 3 {
+			if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
+				return regionID(altRegionIDs[i/3]), nil
+			}
+		}
+		return 0, mkErrInvalid(s)
+	}
+	return 0, errSyntax
+}
+
+func getRegionM49(n int) (regionID, error) {
+	if 0 < n && n <= 999 {
+		const (
+			searchBits = 7
+			regionBits = 9
+			regionMask = 1<<regionBits - 1
+		)
+		idx := n >> searchBits
+		buf := fromM49[m49Index[idx]:m49Index[idx+1]]
+		val := uint16(n) << regionBits // we rely on bits shifting out
+		i := sort.Search(len(buf), func(i int) bool {
+			return buf[i] >= val
+		})
+		if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
+			return regionID(r & regionMask), nil
+		}
+	}
+	var e ValueError
+	fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n)
+	return 0, e
+}
+
+// normRegion returns a region if r is deprecated or 0 otherwise.
+// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
+// TODO: consider mapping split up regions to new most populous one (like CLDR).
+func normRegion(r regionID) regionID {
+	m := regionOldMap
+	k := sort.Search(len(m), func(i int) bool {
+		return m[i].from >= uint16(r)
+	})
+	if k < len(m) && m[k].from == uint16(r) {
+		return regionID(m[k].to)
+	}
+	return 0
+}
+
+const (
+	iso3166UserAssigned = 1 << iota
+	ccTLD
+	bcp47Region
+)
+
+func (r regionID) typ() byte {
+	return regionTypes[r]
+}
+
+// String returns the BCP 47 representation for the region.
+// It returns "ZZ" for an unspecified region.
+func (r regionID) String() string {
+	if r < isoRegionOffset {
+		if r == 0 {
+			return "ZZ"
+		}
+		return fmt.Sprintf("%03d", r.M49())
+	}
+	r -= isoRegionOffset
+	return regionISO.Elem(int(r))[:2]
+}
+
+// ISO3 returns the 3-letter ISO code of r.
+// Note that not all regions have a 3-letter ISO code.
+// In such cases this method returns "ZZZ".
+func (r regionID) ISO3() string {
+	if r < isoRegionOffset {
+		return "ZZZ"
+	}
+	r -= isoRegionOffset
+	reg := regionISO.Elem(int(r))
+	switch reg[2] {
+	case 0:
+		return altRegionISO3[reg[3]:][:3]
+	case ' ':
+		return "ZZZ"
+	}
+	return reg[0:1] + reg[2:4]
+}
+
+// M49 returns the UN M.49 encoding of r, or 0 if this encoding
+// is not defined for r.
+func (r regionID) M49() int {
+	return int(m49[r])
+}
+
+// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
+// may include private-use tags that are assigned by CLDR and used in this
+// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
+func (r regionID) IsPrivateUse() bool {
+	return r.typ()&iso3166UserAssigned != 0
+}
+
+type scriptID uint8
+
+// getScriptID returns the script id for string s. It assumes that s
+// is of the format [A-Z][a-z]{3}.
+func getScriptID(idx tag.Index, s []byte) (scriptID, error) {
+	i, err := findIndex(idx, s, "Zzzz")
+	return scriptID(i), err
+}
+
+// String returns the script code in title case.
+// It returns "Zzzz" for an unspecified script.
+func (s scriptID) String() string {
+	if s == 0 {
+		return "Zzzz"
+	}
+	return script.Elem(int(s))
+}
+
+// IsPrivateUse reports whether this script code is reserved for private use.
+func (s scriptID) IsPrivateUse() bool {
+	return _Qaaa <= s && s <= _Qabx
+}
+
+const (
+	maxAltTaglen = len("en-US-POSIX")
+	maxLen       = maxAltTaglen
+)
+
+var (
+	// grandfatheredMap holds a mapping from legacy and grandfathered tags to
+	// their base language or index to more elaborate tag.
+	grandfatheredMap = map[[maxLen]byte]int16{
+		[maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban
+		[maxLen]byte{'i', '-', 'a', 'm', 'i'}:                          _ami, // i-ami
+		[maxLen]byte{'i', '-', 'b', 'n', 'n'}:                          _bnn, // i-bnn
+		[maxLen]byte{'i', '-', 'h', 'a', 'k'}:                          _hak, // i-hak
+		[maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}:      _tlh, // i-klingon
+		[maxLen]byte{'i', '-', 'l', 'u', 'x'}:                          _lb,  // i-lux
+		[maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}:           _nv,  // i-navajo
+		[maxLen]byte{'i', '-', 'p', 'w', 'n'}:                          _pwn, // i-pwn
+		[maxLen]byte{'i', '-', 't', 'a', 'o'}:                          _tao, // i-tao
+		[maxLen]byte{'i', '-', 't', 'a', 'y'}:                          _tay, // i-tay
+		[maxLen]byte{'i', '-', 't', 's', 'u'}:                          _tsu, // i-tsu
+		[maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}:                     _nb,  // no-bok
+		[maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}:                     _nn,  // no-nyn
+		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}:      _sfb, // sgn-BE-FR
+		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}:      _vgt, // sgn-BE-NL
+		[maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}:      _sgg, // sgn-CH-DE
+		[maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}:           _cmn, // zh-guoyu
+		[maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}:           _hak, // zh-hakka
+		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan
+		[maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}:           _hsn, // zh-xiang
+
+		// Grandfathered tags with no modern replacement will be converted as
+		// follows:
+		[maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish
+		[maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}:           -2, // en-GB-oed
+		[maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}:           -3, // i-default
+		[maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}:      -4, // i-enochian
+		[maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}:                     -5, // i-mingo
+		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}:                          -6, // zh-min
+
+		// CLDR-specific tag.
+		[maxLen]byte{'r', 'o', 'o', 't'}:                                    0,  // root
+		[maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX"
+	}
+
+	altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102}
+
+	altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix"
+)
+
+func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) {
+	if v, ok := grandfatheredMap[s]; ok {
+		if v < 0 {
+			return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
+		}
+		t.lang = langID(v)
+		return t, true
+	}
+	return t, false
+}
diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go
new file mode 100644
index 000000000..8ad950533
--- /dev/null
+++ b/vendor/golang.org/x/text/language/match.go
@@ -0,0 +1,841 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import "errors"
+
+// Matcher is the interface that wraps the Match method.
+//
+// Match returns the best match for any of the given tags, along with
+// a unique index associated with the returned tag and a confidence
+// score.
+type Matcher interface {
+	Match(t ...Tag) (tag Tag, index int, c Confidence)
+}
+
+// Comprehends reports the confidence score for a speaker of a given language
+// to being able to comprehend the written form of an alternative language.
+func Comprehends(speaker, alternative Tag) Confidence {
+	_, _, c := NewMatcher([]Tag{alternative}).Match(speaker)
+	return c
+}
+
+// NewMatcher returns a Matcher that matches an ordered list of preferred tags
+// against a list of supported tags based on written intelligibility, closeness
+// of dialect, equivalence of subtags and various other rules. It is initialized
+// with the list of supported tags. The first element is used as the default
+// value in case no match is found.
+//
+// Its Match method matches the first of the given Tags to reach a certain
+// confidence threshold. The tags passed to Match should therefore be specified
+// in order of preference. Extensions are ignored for matching.
+//
+// The index returned by the Match method corresponds to the index of the
+// matched tag in t, but is augmented with the Unicode extension ('u')of the
+// corresponding preferred tag. This allows user locale options to be passed
+// transparently.
+func NewMatcher(t []Tag) Matcher {
+	return newMatcher(t)
+}
+
+func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) {
+	match, w, c := m.getBest(want...)
+	if match == nil {
+		t = m.default_.tag
+	} else {
+		t, index = match.tag, match.index
+	}
+	// Copy options from the user-provided tag into the result tag. This is hard
+	// to do after the fact, so we do it here.
+	// TODO: consider also adding in variants that are compatible with the
+	// matched language.
+	// TODO: Add back region if it is non-ambiguous? Or create another tag to
+	// preserve the region?
+	if u, ok := w.Extension('u'); ok {
+		t, _ = Raw.Compose(t, u)
+	}
+	return t, index, c
+}
+
+type scriptRegionFlags uint8
+
+const (
+	isList = 1 << iota
+	scriptInFrom
+	regionInFrom
+)
+
+func (t *Tag) setUndefinedLang(id langID) {
+	if t.lang == 0 {
+		t.lang = id
+	}
+}
+
+func (t *Tag) setUndefinedScript(id scriptID) {
+	if t.script == 0 {
+		t.script = id
+	}
+}
+
+func (t *Tag) setUndefinedRegion(id regionID) {
+	if t.region == 0 || t.region.contains(id) {
+		t.region = id
+	}
+}
+
+// ErrMissingLikelyTagsData indicates no information was available
+// to compute likely values of missing tags.
+var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
+
+// addLikelySubtags sets subtags to their most likely value, given the locale.
+// In most cases this means setting fields for unknown values, but in some
+// cases it may alter a value.  It returns a ErrMissingLikelyTagsData error
+// if the given locale cannot be expanded.
+func (t Tag) addLikelySubtags() (Tag, error) {
+	id, err := addTags(t)
+	if err != nil {
+		return t, err
+	} else if id.equalTags(t) {
+		return t, nil
+	}
+	id.remakeString()
+	return id, nil
+}
+
+// specializeRegion attempts to specialize a group region.
+func specializeRegion(t *Tag) bool {
+	if i := regionInclusion[t.region]; i < nRegionGroups {
+		x := likelyRegionGroup[i]
+		if langID(x.lang) == t.lang && scriptID(x.script) == t.script {
+			t.region = regionID(x.region)
+		}
+		return true
+	}
+	return false
+}
+
+func addTags(t Tag) (Tag, error) {
+	// We leave private use identifiers alone.
+	if t.private() {
+		return t, nil
+	}
+	if t.script != 0 && t.region != 0 {
+		if t.lang != 0 {
+			// already fully specified
+			specializeRegion(&t)
+			return t, nil
+		}
+		// Search matches for und-script-region. Note that for these cases
+		// region will never be a group so there is no need to check for this.
+		list := likelyRegion[t.region : t.region+1]
+		if x := list[0]; x.flags&isList != 0 {
+			list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
+		}
+		for _, x := range list {
+			// Deviating from the spec. See match_test.go for details.
+			if scriptID(x.script) == t.script {
+				t.setUndefinedLang(langID(x.lang))
+				return t, nil
+			}
+		}
+	}
+	if t.lang != 0 {
+		// Search matches for lang-script and lang-region, where lang != und.
+		if t.lang < langNoIndexOffset {
+			x := likelyLang[t.lang]
+			if x.flags&isList != 0 {
+				list := likelyLangList[x.region : x.region+uint16(x.script)]
+				if t.script != 0 {
+					for _, x := range list {
+						if scriptID(x.script) == t.script && x.flags&scriptInFrom != 0 {
+							t.setUndefinedRegion(regionID(x.region))
+							return t, nil
+						}
+					}
+				} else if t.region != 0 {
+					count := 0
+					goodScript := true
+					tt := t
+					for _, x := range list {
+						// We visit all entries for which the script was not
+						// defined, including the ones where the region was not
+						// defined. This allows for proper disambiguation within
+						// regions.
+						if x.flags&scriptInFrom == 0 && t.region.contains(regionID(x.region)) {
+							tt.region = regionID(x.region)
+							tt.setUndefinedScript(scriptID(x.script))
+							goodScript = goodScript && tt.script == scriptID(x.script)
+							count++
+						}
+					}
+					if count == 1 {
+						return tt, nil
+					}
+					// Even if we fail to find a unique Region, we might have
+					// an unambiguous script.
+					if goodScript {
+						t.script = tt.script
+					}
+				}
+			}
+		}
+	} else {
+		// Search matches for und-script.
+		if t.script != 0 {
+			x := likelyScript[t.script]
+			if x.region != 0 {
+				t.setUndefinedRegion(regionID(x.region))
+				t.setUndefinedLang(langID(x.lang))
+				return t, nil
+			}
+		}
+		// Search matches for und-region. If und-script-region exists, it would
+		// have been found earlier.
+		if t.region != 0 {
+			if i := regionInclusion[t.region]; i < nRegionGroups {
+				x := likelyRegionGroup[i]
+				if x.region != 0 {
+					t.setUndefinedLang(langID(x.lang))
+					t.setUndefinedScript(scriptID(x.script))
+					t.region = regionID(x.region)
+				}
+			} else {
+				x := likelyRegion[t.region]
+				if x.flags&isList != 0 {
+					x = likelyRegionList[x.lang]
+				}
+				if x.script != 0 && x.flags != scriptInFrom {
+					t.setUndefinedLang(langID(x.lang))
+					t.setUndefinedScript(scriptID(x.script))
+					return t, nil
+				}
+			}
+		}
+	}
+
+	// Search matches for lang.
+	if t.lang < langNoIndexOffset {
+		x := likelyLang[t.lang]
+		if x.flags&isList != 0 {
+			x = likelyLangList[x.region]
+		}
+		if x.region != 0 {
+			t.setUndefinedScript(scriptID(x.script))
+			t.setUndefinedRegion(regionID(x.region))
+		}
+		specializeRegion(&t)
+		if t.lang == 0 {
+			t.lang = _en // default language
+		}
+		return t, nil
+	}
+	return t, ErrMissingLikelyTagsData
+}
+
+func (t *Tag) setTagsFrom(id Tag) {
+	t.lang = id.lang
+	t.script = id.script
+	t.region = id.region
+}
+
+// minimize removes the region or script subtags from t such that
+// t.addLikelySubtags() == t.minimize().addLikelySubtags().
+func (t Tag) minimize() (Tag, error) {
+	t, err := minimizeTags(t)
+	if err != nil {
+		return t, err
+	}
+	t.remakeString()
+	return t, nil
+}
+
+// minimizeTags mimics the behavior of the ICU 51 C implementation.
+func minimizeTags(t Tag) (Tag, error) {
+	if t.equalTags(und) {
+		return t, nil
+	}
+	max, err := addTags(t)
+	if err != nil {
+		return t, err
+	}
+	for _, id := range [...]Tag{
+		{lang: t.lang},
+		{lang: t.lang, region: t.region},
+		{lang: t.lang, script: t.script},
+	} {
+		if x, err := addTags(id); err == nil && max.equalTags(x) {
+			t.setTagsFrom(id)
+			break
+		}
+	}
+	return t, nil
+}
+
+// Tag Matching
+// CLDR defines an algorithm for finding the best match between two sets of language
+// tags. The basic algorithm defines how to score a possible match and then find
+// the match with the best score
+// (see http://www.unicode.org/reports/tr35/#LanguageMatching).
+// Using scoring has several disadvantages. The scoring obfuscates the importance of
+// the various factors considered, making the algorithm harder to understand. Using
+// scoring also requires the full score to be computed for each pair of tags.
+//
+// We will use a different algorithm which aims to have the following properties:
+// - clarity on the precedence of the various selection factors, and
+// - improved performance by allowing early termination of a comparison.
+//
+// Matching algorithm (overview)
+// Input:
+//   - supported: a set of supported tags
+//   - default:   the default tag to return in case there is no match
+//   - desired:   list of desired tags, ordered by preference, starting with
+//                the most-preferred.
+//
+// Algorithm:
+//   1) Set the best match to the lowest confidence level
+//   2) For each tag in "desired":
+//     a) For each tag in "supported":
+//        1) compute the match between the two tags.
+//        2) if the match is better than the previous best match, replace it
+//           with the new match. (see next section)
+//     b) if the current best match is above a certain threshold, return this
+//        match without proceeding to the next tag in "desired". [See Note 1]
+//   3) If the best match so far is below a certain threshold, return "default".
+//
+// Ranking:
+// We use two phases to determine whether one pair of tags are a better match
+// than another pair of tags. First, we determine a rough confidence level. If the
+// levels are different, the one with the highest confidence wins.
+// Second, if the rough confidence levels are identical, we use a set of tie-breaker
+// rules.
+//
+// The confidence level of matching a pair of tags is determined by finding the
+// lowest confidence level of any matches of the corresponding subtags (the
+// result is deemed as good as its weakest link).
+// We define the following levels:
+//   Exact    - An exact match of a subtag, before adding likely subtags.
+//   MaxExact - An exact match of a subtag, after adding likely subtags.
+//              [See Note 2].
+//   High     - High level of mutual intelligibility between different subtag
+//              variants.
+//   Low      - Low level of mutual intelligibility between different subtag
+//              variants.
+//   No       - No mutual intelligibility.
+//
+// The following levels can occur for each type of subtag:
+//   Base:    Exact, MaxExact, High, Low, No
+//   Script:  Exact, MaxExact [see Note 3], Low, No
+//   Region:  Exact, MaxExact, High
+//   Variant: Exact, High
+//   Private: Exact, No
+//
+// Any result with a confidence level of Low or higher is deemed a possible match.
+// Once a desired tag matches any of the supported tags with a level of MaxExact
+// or higher, the next desired tag is not considered (see Step 2.b).
+// Note that CLDR provides languageMatching data that defines close equivalence
+// classes for base languages, scripts and regions.
+//
+// Tie-breaking
+// If we get the same confidence level for two matches, we apply a sequence of
+// tie-breaking rules. The first that succeeds defines the result. The rules are
+// applied in the following order.
+//   1) Original language was defined and was identical.
+//   2) Original region was defined and was identical.
+//   3) Distance between two maximized regions was the smallest.
+//   4) Original script was defined and was identical.
+//   5) Distance from want tag to have tag using the parent relation [see Note 5.]
+// If there is still no winner after these rules are applied, the first match
+// found wins.
+//
+// Notes:
+// [1] Note that even if we may not have a perfect match, if a match is above a
+//     certain threshold, it is considered a better match than any other match
+//     to a tag later in the list of preferred language tags.
+// [2] In practice, as matching of Exact is done in a separate phase from
+//     matching the other levels, we reuse the Exact level to mean MaxExact in
+//     the second phase. As a consequence, we only need the levels defined by
+//     the Confidence type. The MaxExact confidence level is mapped to High in
+//     the public API.
+// [3] We do not differentiate between maximized script values that were derived
+//     from suppressScript versus most likely tag data. We determined that in
+//     ranking the two, one ranks just after the other. Moreover, the two cannot
+//     occur concurrently. As a consequence, they are identical for practical
+//     purposes.
+// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign
+//     the MaxExact level to allow iw vs he to still be a closer match than
+//     en-AU vs en-US, for example.
+// [5] In CLDR a locale inherits fields that are unspecified for this locale
+//     from its parent. Therefore, if a locale is a parent of another locale,
+//     it is a strong measure for closeness, especially when no other tie
+//     breaker rule applies. One could also argue it is inconsistent, for
+//     example, when pt-AO matches pt (which CLDR equates with pt-BR), even
+//     though its parent is pt-PT according to the inheritance rules.
+//
+// Implementation Details:
+// There are several performance considerations worth pointing out. Most notably,
+// we preprocess as much as possible (within reason) at the time of creation of a
+// matcher. This includes:
+//   - creating a per-language map, which includes data for the raw base language
+//     and its canonicalized variant (if applicable),
+//   - expanding entries for the equivalence classes defined in CLDR's
+//     languageMatch data.
+// The per-language map ensures that typically only a very small number of tags
+// need to be considered. The pre-expansion of canonicalized subtags and
+// equivalence classes reduces the amount of map lookups that need to be done at
+// runtime.
+
+// matcher keeps a set of supported language tags, indexed by language.
+type matcher struct {
+	default_     *haveTag
+	index        map[langID]*matchHeader
+	passSettings bool
+}
+
+// matchHeader has the lists of tags for exact matches and matches based on
+// maximized and canonicalized tags for a given language.
+type matchHeader struct {
+	exact []*haveTag
+	max   []*haveTag
+}
+
+// haveTag holds a supported Tag and its maximized script and region. The maximized
+// or canonicalized language is not stored as it is not needed during matching.
+type haveTag struct {
+	tag Tag
+
+	// index of this tag in the original list of supported tags.
+	index int
+
+	// conf is the maximum confidence that can result from matching this haveTag.
+	// When conf < Exact this means it was inserted after applying a CLDR equivalence rule.
+	conf Confidence
+
+	// Maximized region and script.
+	maxRegion regionID
+	maxScript scriptID
+
+	// altScript may be checked as an alternative match to maxScript. If altScript
+	// matches, the confidence level for this match is Low. Theoretically there
+	// could be multiple alternative scripts. This does not occur in practice.
+	altScript scriptID
+
+	// nextMax is the index of the next haveTag with the same maximized tags.
+	nextMax uint16
+}
+
+func makeHaveTag(tag Tag, index int) (haveTag, langID) {
+	max := tag
+	if tag.lang != 0 {
+		max, _ = max.canonicalize(All)
+		max, _ = addTags(max)
+		max.remakeString()
+	}
+	return haveTag{tag, index, Exact, max.region, max.script, altScript(max.lang, max.script), 0}, max.lang
+}
+
+// altScript returns an alternative script that may match the given script with
+// a low confidence.  At the moment, the langMatch data allows for at most one
+// script to map to another and we rely on this to keep the code simple.
+func altScript(l langID, s scriptID) scriptID {
+	for _, alt := range matchScript {
+		if (alt.lang == 0 || langID(alt.lang) == l) && scriptID(alt.have) == s {
+			return scriptID(alt.want)
+		}
+	}
+	return 0
+}
+
+// addIfNew adds a haveTag to the list of tags only if it is a unique tag.
+// Tags that have the same maximized values are linked by index.
+func (h *matchHeader) addIfNew(n haveTag, exact bool) {
+	// Don't add new exact matches.
+	for _, v := range h.exact {
+		if v.tag.equalsRest(n.tag) {
+			return
+		}
+	}
+	if exact {
+		h.exact = append(h.exact, &n)
+	}
+	// Allow duplicate maximized tags, but create a linked list to allow quickly
+	// comparing the equivalents and bail out.
+	for i, v := range h.max {
+		if v.maxScript == n.maxScript &&
+			v.maxRegion == n.maxRegion &&
+			v.tag.variantOrPrivateTagStr() == n.tag.variantOrPrivateTagStr() {
+			for h.max[i].nextMax != 0 {
+				i = int(h.max[i].nextMax)
+			}
+			h.max[i].nextMax = uint16(len(h.max))
+			break
+		}
+	}
+	h.max = append(h.max, &n)
+}
+
+// header returns the matchHeader for the given language. It creates one if
+// it doesn't already exist.
+func (m *matcher) header(l langID) *matchHeader {
+	if h := m.index[l]; h != nil {
+		return h
+	}
+	h := &matchHeader{}
+	m.index[l] = h
+	return h
+}
+
+// newMatcher builds an index for the given supported tags and returns it as
+// a matcher. It also expands the index by considering various equivalence classes
+// for a given tag.
+func newMatcher(supported []Tag) *matcher {
+	m := &matcher{
+		index: make(map[langID]*matchHeader),
+	}
+	if len(supported) == 0 {
+		m.default_ = &haveTag{}
+		return m
+	}
+	// Add supported languages to the index. Add exact matches first to give
+	// them precedence.
+	for i, tag := range supported {
+		pair, _ := makeHaveTag(tag, i)
+		m.header(tag.lang).addIfNew(pair, true)
+	}
+	m.default_ = m.header(supported[0].lang).exact[0]
+	for i, tag := range supported {
+		pair, max := makeHaveTag(tag, i)
+		if max != tag.lang {
+			m.header(max).addIfNew(pair, false)
+		}
+	}
+
+	// update is used to add indexes in the map for equivalent languages.
+	// If force is true, the update will also apply to derived entries. To
+	// avoid applying a "transitive closure", use false.
+	update := func(want, have uint16, conf Confidence, force bool) {
+		if hh := m.index[langID(have)]; hh != nil {
+			if !force && len(hh.exact) == 0 {
+				return
+			}
+			hw := m.header(langID(want))
+			for _, ht := range hh.max {
+				v := *ht
+				if conf < v.conf {
+					v.conf = conf
+				}
+				v.nextMax = 0 // this value needs to be recomputed
+				if v.altScript != 0 {
+					v.altScript = altScript(langID(want), v.maxScript)
+				}
+				hw.addIfNew(v, conf == Exact && len(hh.exact) > 0)
+			}
+		}
+	}
+
+	// Add entries for languages with mutual intelligibility as defined by CLDR's
+	// languageMatch data.
+	for _, ml := range matchLang {
+		update(ml.want, ml.have, Confidence(ml.conf), false)
+		if !ml.oneway {
+			update(ml.have, ml.want, Confidence(ml.conf), false)
+		}
+	}
+
+	// Add entries for possible canonicalizations. This is an optimization to
+	// ensure that only one map lookup needs to be done at runtime per desired tag.
+	// First we match deprecated equivalents. If they are perfect equivalents
+	// (their canonicalization simply substitutes a different language code, but
+	// nothing else), the match confidence is Exact, otherwise it is High.
+	for i, lm := range langAliasMap {
+		if lm.from == _sh {
+			continue
+		}
+
+		// If deprecated codes match and there is no fiddling with the script or
+		// or region, we consider it an exact match.
+		conf := Exact
+		if langAliasTypes[i] != langMacro {
+			if !isExactEquivalent(langID(lm.from)) {
+				conf = High
+			}
+			update(lm.to, lm.from, conf, true)
+		}
+		update(lm.from, lm.to, conf, true)
+	}
+	return m
+}
+
+// getBest gets the best matching tag in m for any of the given tags, taking into
+// account the order of preference of the given tags.
+func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) {
+	best := bestMatch{}
+	for _, w := range want {
+		var max Tag
+		// Check for exact match first.
+		h := m.index[w.lang]
+		if w.lang != 0 {
+			// Base language is defined.
+			if h == nil {
+				continue
+			}
+			for i := range h.exact {
+				have := h.exact[i]
+				if have.tag.equalsRest(w) {
+					return have, w, Exact
+				}
+			}
+			max, _ = w.canonicalize(Legacy | Deprecated)
+			max, _ = addTags(max)
+		} else {
+			// Base language is not defined.
+			if h != nil {
+				for i := range h.exact {
+					have := h.exact[i]
+					if have.tag.equalsRest(w) {
+						return have, w, Exact
+					}
+				}
+			}
+			if w.script == 0 && w.region == 0 {
+				// We skip all tags matching und for approximate matching, including
+				// private tags.
+				continue
+			}
+			max, _ = addTags(w)
+			if h = m.index[max.lang]; h == nil {
+				continue
+			}
+		}
+		// Check for match based on maximized tag.
+		for i := range h.max {
+			have := h.max[i]
+			best.update(have, w, max.script, max.region)
+			if best.conf == Exact {
+				for have.nextMax != 0 {
+					have = h.max[have.nextMax]
+					best.update(have, w, max.script, max.region)
+				}
+				return best.have, best.want, High
+			}
+		}
+	}
+	if best.conf <= No {
+		if len(want) != 0 {
+			return nil, want[0], No
+		}
+		return nil, Tag{}, No
+	}
+	return best.have, best.want, best.conf
+}
+
+// bestMatch accumulates the best match so far.
+type bestMatch struct {
+	have *haveTag
+	want Tag
+	conf Confidence
+	// Cached results from applying tie-breaking rules.
+	origLang   bool
+	origReg    bool
+	regDist    uint8
+	origScript bool
+	parentDist uint8 // 255 if have is not an ancestor of want tag.
+}
+
+// update updates the existing best match if the new pair is considered to be a
+// better match.
+// To determine if the given pair is a better match, it first computes the rough
+// confidence level. If this surpasses the current match, it will replace it and
+// update the tie-breaker rule cache. If there is a tie, it proceeds with applying
+// a series of tie-breaker rules. If there is no conclusive winner after applying
+// the tie-breaker rules, it leaves the current match as the preferred match.
+func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion regionID) {
+	// Bail if the maximum attainable confidence is below that of the current best match.
+	c := have.conf
+	if c < m.conf {
+		return
+	}
+	if have.maxScript != maxScript {
+		// There is usually very little comprehension between different scripts.
+		// In a few cases there may still be Low comprehension. This possibility is
+		// pre-computed and stored in have.altScript.
+		if Low < m.conf || have.altScript != maxScript {
+			return
+		}
+		c = Low
+	} else if have.maxRegion != maxRegion {
+		// There is usually a small difference between languages across regions.
+		// We use the region distance (below) to disambiguate between equal matches.
+		if High < c {
+			c = High
+		}
+	}
+
+	// We store the results of the computations of the tie-breaker rules along
+	// with the best match. There is no need to do the checks once we determine
+	// we have a winner, but we do still need to do the tie-breaker computations.
+	// We use "beaten" to keep track if we still need to do the checks.
+	beaten := false // true if the new pair defeats the current one.
+	if c != m.conf {
+		if c < m.conf {
+			return
+		}
+		beaten = true
+	}
+
+	// Tie-breaker rules:
+	// We prefer if the pre-maximized language was specified and identical.
+	origLang := have.tag.lang == tag.lang && tag.lang != 0
+	if !beaten && m.origLang != origLang {
+		if m.origLang {
+			return
+		}
+		beaten = true
+	}
+
+	// We prefer if the pre-maximized region was specified and identical.
+	origReg := have.tag.region == tag.region && tag.region != 0
+	if !beaten && m.origReg != origReg {
+		if m.origReg {
+			return
+		}
+		beaten = true
+	}
+
+	// Next we prefer smaller distances between regions, as defined by regionDist.
+	regDist := regionDist(have.maxRegion, maxRegion, tag.lang)
+	if !beaten && m.regDist != regDist {
+		if regDist > m.regDist {
+			return
+		}
+		beaten = true
+	}
+
+	// Next we prefer if the pre-maximized script was specified and identical.
+	origScript := have.tag.script == tag.script && tag.script != 0
+	if !beaten && m.origScript != origScript {
+		if m.origScript {
+			return
+		}
+		beaten = true
+	}
+
+	// Finally we prefer tags which have a closer parent relationship.
+	parentDist := parentDistance(have.tag.region, tag)
+	if !beaten && m.parentDist != parentDist {
+		if parentDist > m.parentDist {
+			return
+		}
+		beaten = true
+	}
+
+	// Update m to the newly found best match.
+	if beaten {
+		m.have = have
+		m.want = tag
+		m.conf = c
+		m.origLang = origLang
+		m.origReg = origReg
+		m.origScript = origScript
+		m.regDist = regDist
+		m.parentDist = parentDist
+	}
+}
+
+// parentDistance returns the number of times Parent must be called before the
+// regions match. It is assumed that it has already been checked that lang and
+// script are identical. If haveRegion does not occur in the ancestor chain of
+// tag, it returns 255.
+func parentDistance(haveRegion regionID, tag Tag) uint8 {
+	p := tag.Parent()
+	d := uint8(1)
+	for haveRegion != p.region {
+		if p.region == 0 {
+			return 255
+		}
+		p = p.Parent()
+		d++
+	}
+	return d
+}
+
+// regionDist wraps regionDistance with some exceptions to the algorithmic distance.
+func regionDist(a, b regionID, lang langID) uint8 {
+	if lang == _en {
+		// Two variants of non-US English are close to each other, regardless of distance.
+		if a != _US && b != _US {
+			return 2
+		}
+	}
+	return uint8(regionDistance(a, b))
+}
+
+// regionDistance computes the distance between two regions based on the
+// distance in the graph of region containments as defined in CLDR. It iterates
+// over increasingly inclusive sets of groups, represented as bit vectors, until
+// the source bit vector has bits in common with the destination vector.
+func regionDistance(a, b regionID) int {
+	if a == b {
+		return 0
+	}
+	p, q := regionInclusion[a], regionInclusion[b]
+	if p < nRegionGroups {
+		p, q = q, p
+	}
+	set := regionInclusionBits
+	if q < nRegionGroups && set[p]&(1<<q) != 0 {
+		return 1
+	}
+	d := 2
+	for goal := set[q]; set[p]&goal == 0; p = regionInclusionNext[p] {
+		d++
+	}
+	return d
+}
+
+func (t Tag) variants() string {
+	if t.pVariant == 0 {
+		return ""
+	}
+	return t.str[t.pVariant:t.pExt]
+}
+
+// variantOrPrivateTagStr returns variants or private use tags.
+func (t Tag) variantOrPrivateTagStr() string {
+	if t.pExt > 0 {
+		return t.str[t.pVariant:t.pExt]
+	}
+	return t.str[t.pVariant:]
+}
+
+// equalsRest compares everything except the language.
+func (a Tag) equalsRest(b Tag) bool {
+	// TODO: don't include extensions in this comparison. To do this efficiently,
+	// though, we should handle private tags separately.
+	return a.script == b.script && a.region == b.region && a.variantOrPrivateTagStr() == b.variantOrPrivateTagStr()
+}
+
+// isExactEquivalent returns true if canonicalizing the language will not alter
+// the script or region of a tag.
+func isExactEquivalent(l langID) bool {
+	for _, o := range notEquivalent {
+		if o == l {
+			return false
+		}
+	}
+	return true
+}
+
+var notEquivalent []langID
+
+func init() {
+	// Create a list of all languages for which canonicalization may alter the
+	// script or region.
+	for _, lm := range langAliasMap {
+		tag := Tag{lang: langID(lm.from)}
+		if tag, _ = tag.canonicalize(All); tag.script != 0 || tag.region != 0 {
+			notEquivalent = append(notEquivalent, langID(lm.from))
+		}
+	}
+}
diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go
new file mode 100644
index 000000000..cfa28f56e
--- /dev/null
+++ b/vendor/golang.org/x/text/language/parse.go
@@ -0,0 +1,859 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+	"bytes"
+	"errors"
+	"fmt"
+	"sort"
+	"strconv"
+	"strings"
+
+	"golang.org/x/text/internal/tag"
+)
+
+// isAlpha returns true if the byte is not a digit.
+// b must be an ASCII letter or digit.
+func isAlpha(b byte) bool {
+	return b > '9'
+}
+
+// isAlphaNum returns true if the string contains only ASCII letters or digits.
+func isAlphaNum(s []byte) bool {
+	for _, c := range s {
+		if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
+			return false
+		}
+	}
+	return true
+}
+
+// errSyntax is returned by any of the parsing functions when the
+// input is not well-formed, according to BCP 47.
+// TODO: return the position at which the syntax error occurred?
+var errSyntax = errors.New("language: tag is not well-formed")
+
+// ValueError is returned by any of the parsing functions when the
+// input is well-formed but the respective subtag is not recognized
+// as a valid value.
+type ValueError struct {
+	v [8]byte
+}
+
+func mkErrInvalid(s []byte) error {
+	var e ValueError
+	copy(e.v[:], s)
+	return e
+}
+
+func (e ValueError) tag() []byte {
+	n := bytes.IndexByte(e.v[:], 0)
+	if n == -1 {
+		n = 8
+	}
+	return e.v[:n]
+}
+
+// Error implements the error interface.
+func (e ValueError) Error() string {
+	return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
+}
+
+// Subtag returns the subtag for which the error occurred.
+func (e ValueError) Subtag() string {
+	return string(e.tag())
+}
+
+// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
+type scanner struct {
+	b     []byte
+	bytes [max99thPercentileSize]byte
+	token []byte
+	start int // start position of the current token
+	end   int // end position of the current token
+	next  int // next point for scan
+	err   error
+	done  bool
+}
+
+func makeScannerString(s string) scanner {
+	scan := scanner{}
+	if len(s) <= len(scan.bytes) {
+		scan.b = scan.bytes[:copy(scan.bytes[:], s)]
+	} else {
+		scan.b = []byte(s)
+	}
+	scan.init()
+	return scan
+}
+
+// makeScanner returns a scanner using b as the input buffer.
+// b is not copied and may be modified by the scanner routines.
+func makeScanner(b []byte) scanner {
+	scan := scanner{b: b}
+	scan.init()
+	return scan
+}
+
+func (s *scanner) init() {
+	for i, c := range s.b {
+		if c == '_' {
+			s.b[i] = '-'
+		}
+	}
+	s.scan()
+}
+
+// restToLower converts the string between start and end to lower case.
+func (s *scanner) toLower(start, end int) {
+	for i := start; i < end; i++ {
+		c := s.b[i]
+		if 'A' <= c && c <= 'Z' {
+			s.b[i] += 'a' - 'A'
+		}
+	}
+}
+
+func (s *scanner) setError(e error) {
+	if s.err == nil || (e == errSyntax && s.err != errSyntax) {
+		s.err = e
+	}
+}
+
+// resizeRange shrinks or grows the array at position oldStart such that
+// a new string of size newSize can fit between oldStart and oldEnd.
+// Sets the scan point to after the resized range.
+func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
+	s.start = oldStart
+	if end := oldStart + newSize; end != oldEnd {
+		diff := end - oldEnd
+		if end < cap(s.b) {
+			b := make([]byte, len(s.b)+diff)
+			copy(b, s.b[:oldStart])
+			copy(b[end:], s.b[oldEnd:])
+			s.b = b
+		} else {
+			s.b = append(s.b[end:], s.b[oldEnd:]...)
+		}
+		s.next = end + (s.next - s.end)
+		s.end = end
+	}
+}
+
+// replace replaces the current token with repl.
+func (s *scanner) replace(repl string) {
+	s.resizeRange(s.start, s.end, len(repl))
+	copy(s.b[s.start:], repl)
+}
+
+// gobble removes the current token from the input.
+// Caller must call scan after calling gobble.
+func (s *scanner) gobble(e error) {
+	s.setError(e)
+	if s.start == 0 {
+		s.b = s.b[:+copy(s.b, s.b[s.next:])]
+		s.end = 0
+	} else {
+		s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
+		s.end = s.start - 1
+	}
+	s.next = s.start
+}
+
+// deleteRange removes the given range from s.b before the current token.
+func (s *scanner) deleteRange(start, end int) {
+	s.setError(errSyntax)
+	s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
+	diff := end - start
+	s.next -= diff
+	s.start -= diff
+	s.end -= diff
+}
+
+// scan parses the next token of a BCP 47 string.  Tokens that are larger
+// than 8 characters or include non-alphanumeric characters result in an error
+// and are gobbled and removed from the output.
+// It returns the end position of the last token consumed.
+func (s *scanner) scan() (end int) {
+	end = s.end
+	s.token = nil
+	for s.start = s.next; s.next < len(s.b); {
+		i := bytes.IndexByte(s.b[s.next:], '-')
+		if i == -1 {
+			s.end = len(s.b)
+			s.next = len(s.b)
+			i = s.end - s.start
+		} else {
+			s.end = s.next + i
+			s.next = s.end + 1
+		}
+		token := s.b[s.start:s.end]
+		if i < 1 || i > 8 || !isAlphaNum(token) {
+			s.gobble(errSyntax)
+			continue
+		}
+		s.token = token
+		return end
+	}
+	if n := len(s.b); n > 0 && s.b[n-1] == '-' {
+		s.setError(errSyntax)
+		s.b = s.b[:len(s.b)-1]
+	}
+	s.done = true
+	return end
+}
+
+// acceptMinSize parses multiple tokens of the given size or greater.
+// It returns the end position of the last token consumed.
+func (s *scanner) acceptMinSize(min int) (end int) {
+	end = s.end
+	s.scan()
+	for ; len(s.token) >= min; s.scan() {
+		end = s.end
+	}
+	return end
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// The resulting tag is canonicalized using the default canonicalization type.
+func Parse(s string) (t Tag, err error) {
+	return Default.Parse(s)
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// The resulting tag is canonicalized using the the canonicalization type c.
+func (c CanonType) Parse(s string) (t Tag, err error) {
+	// TODO: consider supporting old-style locale key-value pairs.
+	if s == "" {
+		return und, errSyntax
+	}
+	if len(s) <= maxAltTaglen {
+		b := [maxAltTaglen]byte{}
+		for i, c := range s {
+			// Generating invalid UTF-8 is okay as it won't match.
+			if 'A' <= c && c <= 'Z' {
+				c += 'a' - 'A'
+			} else if c == '_' {
+				c = '-'
+			}
+			b[i] = byte(c)
+		}
+		if t, ok := grandfathered(b); ok {
+			return t, nil
+		}
+	}
+	scan := makeScannerString(s)
+	t, err = parse(&scan, s)
+	t, changed := t.canonicalize(c)
+	if changed {
+		t.remakeString()
+	}
+	return t, err
+}
+
+func parse(scan *scanner, s string) (t Tag, err error) {
+	t = und
+	var end int
+	if n := len(scan.token); n <= 1 {
+		scan.toLower(0, len(scan.b))
+		if n == 0 || scan.token[0] != 'x' {
+			return t, errSyntax
+		}
+		end = parseExtensions(scan)
+	} else if n >= 4 {
+		return und, errSyntax
+	} else { // the usual case
+		t, end = parseTag(scan)
+		if n := len(scan.token); n == 1 {
+			t.pExt = uint16(end)
+			end = parseExtensions(scan)
+		} else if end < len(scan.b) {
+			scan.setError(errSyntax)
+			scan.b = scan.b[:end]
+		}
+	}
+	if int(t.pVariant) < len(scan.b) {
+		if end < len(s) {
+			s = s[:end]
+		}
+		if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
+			t.str = s
+		} else {
+			t.str = string(scan.b)
+		}
+	} else {
+		t.pVariant, t.pExt = 0, 0
+	}
+	return t, scan.err
+}
+
+// parseTag parses language, script, region and variants.
+// It returns a Tag and the end position in the input that was parsed.
+func parseTag(scan *scanner) (t Tag, end int) {
+	var e error
+	// TODO: set an error if an unknown lang, script or region is encountered.
+	t.lang, e = getLangID(scan.token)
+	scan.setError(e)
+	scan.replace(t.lang.String())
+	langStart := scan.start
+	end = scan.scan()
+	for len(scan.token) == 3 && isAlpha(scan.token[0]) {
+		// From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
+		// to a tag of the form <extlang>.
+		lang, e := getLangID(scan.token)
+		if lang != 0 {
+			t.lang = lang
+			copy(scan.b[langStart:], lang.String())
+			scan.b[langStart+3] = '-'
+			scan.start = langStart + 4
+		}
+		scan.gobble(e)
+		end = scan.scan()
+	}
+	if len(scan.token) == 4 && isAlpha(scan.token[0]) {
+		t.script, e = getScriptID(script, scan.token)
+		if t.script == 0 {
+			scan.gobble(e)
+		}
+		end = scan.scan()
+	}
+	if n := len(scan.token); n >= 2 && n <= 3 {
+		t.region, e = getRegionID(scan.token)
+		if t.region == 0 {
+			scan.gobble(e)
+		} else {
+			scan.replace(t.region.String())
+		}
+		end = scan.scan()
+	}
+	scan.toLower(scan.start, len(scan.b))
+	t.pVariant = byte(end)
+	end = parseVariants(scan, end, t)
+	t.pExt = uint16(end)
+	return t, end
+}
+
+var separator = []byte{'-'}
+
+// parseVariants scans tokens as long as each token is a valid variant string.
+// Duplicate variants are removed.
+func parseVariants(scan *scanner, end int, t Tag) int {
+	start := scan.start
+	varIDBuf := [4]uint8{}
+	variantBuf := [4][]byte{}
+	varID := varIDBuf[:0]
+	variant := variantBuf[:0]
+	last := -1
+	needSort := false
+	for ; len(scan.token) >= 4; scan.scan() {
+		// TODO: measure the impact of needing this conversion and redesign
+		// the data structure if there is an issue.
+		v, ok := variantIndex[string(scan.token)]
+		if !ok {
+			// unknown variant
+			// TODO: allow user-defined variants?
+			scan.gobble(mkErrInvalid(scan.token))
+			continue
+		}
+		varID = append(varID, v)
+		variant = append(variant, scan.token)
+		if !needSort {
+			if last < int(v) {
+				last = int(v)
+			} else {
+				needSort = true
+				// There is no legal combinations of more than 7 variants
+				// (and this is by no means a useful sequence).
+				const maxVariants = 8
+				if len(varID) > maxVariants {
+					break
+				}
+			}
+		}
+		end = scan.end
+	}
+	if needSort {
+		sort.Sort(variantsSort{varID, variant})
+		k, l := 0, -1
+		for i, v := range varID {
+			w := int(v)
+			if l == w {
+				// Remove duplicates.
+				continue
+			}
+			varID[k] = varID[i]
+			variant[k] = variant[i]
+			k++
+			l = w
+		}
+		if str := bytes.Join(variant[:k], separator); len(str) == 0 {
+			end = start - 1
+		} else {
+			scan.resizeRange(start, end, len(str))
+			copy(scan.b[scan.start:], str)
+			end = scan.end
+		}
+	}
+	return end
+}
+
+type variantsSort struct {
+	i []uint8
+	v [][]byte
+}
+
+func (s variantsSort) Len() int {
+	return len(s.i)
+}
+
+func (s variantsSort) Swap(i, j int) {
+	s.i[i], s.i[j] = s.i[j], s.i[i]
+	s.v[i], s.v[j] = s.v[j], s.v[i]
+}
+
+func (s variantsSort) Less(i, j int) bool {
+	return s.i[i] < s.i[j]
+}
+
+type bytesSort [][]byte
+
+func (b bytesSort) Len() int {
+	return len(b)
+}
+
+func (b bytesSort) Swap(i, j int) {
+	b[i], b[j] = b[j], b[i]
+}
+
+func (b bytesSort) Less(i, j int) bool {
+	return bytes.Compare(b[i], b[j]) == -1
+}
+
+// parseExtensions parses and normalizes the extensions in the buffer.
+// It returns the last position of scan.b that is part of any extension.
+// It also trims scan.b to remove excess parts accordingly.
+func parseExtensions(scan *scanner) int {
+	start := scan.start
+	exts := [][]byte{}
+	private := []byte{}
+	end := scan.end
+	for len(scan.token) == 1 {
+		extStart := scan.start
+		ext := scan.token[0]
+		end = parseExtension(scan)
+		extension := scan.b[extStart:end]
+		if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
+			scan.setError(errSyntax)
+			end = extStart
+			continue
+		} else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
+			scan.b = scan.b[:end]
+			return end
+		} else if ext == 'x' {
+			private = extension
+			break
+		}
+		exts = append(exts, extension)
+	}
+	sort.Sort(bytesSort(exts))
+	if len(private) > 0 {
+		exts = append(exts, private)
+	}
+	scan.b = scan.b[:start]
+	if len(exts) > 0 {
+		scan.b = append(scan.b, bytes.Join(exts, separator)...)
+	} else if start > 0 {
+		// Strip trailing '-'.
+		scan.b = scan.b[:start-1]
+	}
+	return end
+}
+
+// parseExtension parses a single extension and returns the position of
+// the extension end.
+func parseExtension(scan *scanner) int {
+	start, end := scan.start, scan.end
+	switch scan.token[0] {
+	case 'u':
+		attrStart := end
+		scan.scan()
+		for last := []byte{}; len(scan.token) > 2; scan.scan() {
+			if bytes.Compare(scan.token, last) != -1 {
+				// Attributes are unsorted. Start over from scratch.
+				p := attrStart + 1
+				scan.next = p
+				attrs := [][]byte{}
+				for scan.scan(); len(scan.token) > 2; scan.scan() {
+					attrs = append(attrs, scan.token)
+					end = scan.end
+				}
+				sort.Sort(bytesSort(attrs))
+				copy(scan.b[p:], bytes.Join(attrs, separator))
+				break
+			}
+			last = scan.token
+			end = scan.end
+		}
+		var last, key []byte
+		for attrEnd := end; len(scan.token) == 2; last = key {
+			key = scan.token
+			keyEnd := scan.end
+			end = scan.acceptMinSize(3)
+			// TODO: check key value validity
+			if keyEnd == end || bytes.Compare(key, last) != 1 {
+				// We have an invalid key or the keys are not sorted.
+				// Start scanning keys from scratch and reorder.
+				p := attrEnd + 1
+				scan.next = p
+				keys := [][]byte{}
+				for scan.scan(); len(scan.token) == 2; {
+					keyStart, keyEnd := scan.start, scan.end
+					end = scan.acceptMinSize(3)
+					if keyEnd != end {
+						keys = append(keys, scan.b[keyStart:end])
+					} else {
+						scan.setError(errSyntax)
+						end = keyStart
+					}
+				}
+				sort.Sort(bytesSort(keys))
+				reordered := bytes.Join(keys, separator)
+				if e := p + len(reordered); e < end {
+					scan.deleteRange(e, end)
+					end = e
+				}
+				copy(scan.b[p:], bytes.Join(keys, separator))
+				break
+			}
+		}
+	case 't':
+		scan.scan()
+		if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
+			_, end = parseTag(scan)
+			scan.toLower(start, end)
+		}
+		for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
+			end = scan.acceptMinSize(3)
+		}
+	case 'x':
+		end = scan.acceptMinSize(1)
+	default:
+		end = scan.acceptMinSize(2)
+	}
+	return end
+}
+
+// Compose creates a Tag from individual parts, which may be of type Tag, Base,
+// Script, Region, Variant, []Variant, Extension, []Extension or error. If a
+// Base, Script or Region or slice of type Variant or Extension is passed more
+// than once, the latter will overwrite the former. Variants and Extensions are
+// accumulated, but if two extensions of the same type are passed, the latter
+// will replace the former. A Tag overwrites all former values and typically
+// only makes sense as the first argument. The resulting tag is returned after
+// canonicalizing using the Default CanonType. If one or more errors are
+// encountered, one of the errors is returned.
+func Compose(part ...interface{}) (t Tag, err error) {
+	return Default.Compose(part...)
+}
+
+// Compose creates a Tag from individual parts, which may be of type Tag, Base,
+// Script, Region, Variant, []Variant, Extension, []Extension or error. If a
+// Base, Script or Region or slice of type Variant or Extension is passed more
+// than once, the latter will overwrite the former. Variants and Extensions are
+// accumulated, but if two extensions of the same type are passed, the latter
+// will replace the former. A Tag overwrites all former values and typically
+// only makes sense as the first argument. The resulting tag is returned after
+// canonicalizing using CanonType c. If one or more errors are encountered,
+// one of the errors is returned.
+func (c CanonType) Compose(part ...interface{}) (t Tag, err error) {
+	var b builder
+	if err = b.update(part...); err != nil {
+		return und, err
+	}
+	t, _ = b.tag.canonicalize(c)
+
+	if len(b.ext) > 0 || len(b.variant) > 0 {
+		sort.Sort(sortVariant(b.variant))
+		sort.Strings(b.ext)
+		if b.private != "" {
+			b.ext = append(b.ext, b.private)
+		}
+		n := maxCoreSize + tokenLen(b.variant...) + tokenLen(b.ext...)
+		buf := make([]byte, n)
+		p := t.genCoreBytes(buf)
+		t.pVariant = byte(p)
+		p += appendTokens(buf[p:], b.variant...)
+		t.pExt = uint16(p)
+		p += appendTokens(buf[p:], b.ext...)
+		t.str = string(buf[:p])
+	} else if b.private != "" {
+		t.str = b.private
+		t.remakeString()
+	}
+	return
+}
+
+type builder struct {
+	tag Tag
+
+	private string // the x extension
+	ext     []string
+	variant []string
+
+	err error
+}
+
+func (b *builder) addExt(e string) {
+	if e == "" {
+	} else if e[0] == 'x' {
+		b.private = e
+	} else {
+		b.ext = append(b.ext, e)
+	}
+}
+
+var errInvalidArgument = errors.New("invalid Extension or Variant")
+
+func (b *builder) update(part ...interface{}) (err error) {
+	replace := func(l *[]string, s string, eq func(a, b string) bool) bool {
+		if s == "" {
+			b.err = errInvalidArgument
+			return true
+		}
+		for i, v := range *l {
+			if eq(v, s) {
+				(*l)[i] = s
+				return true
+			}
+		}
+		return false
+	}
+	for _, x := range part {
+		switch v := x.(type) {
+		case Tag:
+			b.tag.lang = v.lang
+			b.tag.region = v.region
+			b.tag.script = v.script
+			if v.str != "" {
+				b.variant = nil
+				for x, s := "", v.str[v.pVariant:v.pExt]; s != ""; {
+					x, s = nextToken(s)
+					b.variant = append(b.variant, x)
+				}
+				b.ext, b.private = nil, ""
+				for i, e := int(v.pExt), ""; i < len(v.str); {
+					i, e = getExtension(v.str, i)
+					b.addExt(e)
+				}
+			}
+		case Base:
+			b.tag.lang = v.langID
+		case Script:
+			b.tag.script = v.scriptID
+		case Region:
+			b.tag.region = v.regionID
+		case Variant:
+			if !replace(&b.variant, v.variant, func(a, b string) bool { return a == b }) {
+				b.variant = append(b.variant, v.variant)
+			}
+		case Extension:
+			if !replace(&b.ext, v.s, func(a, b string) bool { return a[0] == b[0] }) {
+				b.addExt(v.s)
+			}
+		case []Variant:
+			b.variant = nil
+			for _, x := range v {
+				b.update(x)
+			}
+		case []Extension:
+			b.ext, b.private = nil, ""
+			for _, e := range v {
+				b.update(e)
+			}
+		// TODO: support parsing of raw strings based on morphology or just extensions?
+		case error:
+			err = v
+		}
+	}
+	return
+}
+
+func tokenLen(token ...string) (n int) {
+	for _, t := range token {
+		n += len(t) + 1
+	}
+	return
+}
+
+func appendTokens(b []byte, token ...string) int {
+	p := 0
+	for _, t := range token {
+		b[p] = '-'
+		copy(b[p+1:], t)
+		p += 1 + len(t)
+	}
+	return p
+}
+
+type sortVariant []string
+
+func (s sortVariant) Len() int {
+	return len(s)
+}
+
+func (s sortVariant) Swap(i, j int) {
+	s[j], s[i] = s[i], s[j]
+}
+
+func (s sortVariant) Less(i, j int) bool {
+	return variantIndex[s[i]] < variantIndex[s[j]]
+}
+
+func findExt(list []string, x byte) int {
+	for i, e := range list {
+		if e[0] == x {
+			return i
+		}
+	}
+	return -1
+}
+
+// getExtension returns the name, body and end position of the extension.
+func getExtension(s string, p int) (end int, ext string) {
+	if s[p] == '-' {
+		p++
+	}
+	if s[p] == 'x' {
+		return len(s), s[p:]
+	}
+	end = nextExtension(s, p)
+	return end, s[p:end]
+}
+
+// nextExtension finds the next extension within the string, searching
+// for the -<char>- pattern from position p.
+// In the fast majority of cases, language tags will have at most
+// one extension and extensions tend to be small.
+func nextExtension(s string, p int) int {
+	for n := len(s) - 3; p < n; {
+		if s[p] == '-' {
+			if s[p+2] == '-' {
+				return p
+			}
+			p += 3
+		} else {
+			p++
+		}
+	}
+	return len(s)
+}
+
+var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight")
+
+// ParseAcceptLanguage parses the contents of a Accept-Language header as
+// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and
+// a list of corresponding quality weights. It is more permissive than RFC 2616
+// and may return non-nil slices even if the input is not valid.
+// The Tags will be sorted by highest weight first and then by first occurrence.
+// Tags with a weight of zero will be dropped. An error will be returned if the
+// input could not be parsed.
+func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) {
+	var entry string
+	for s != "" {
+		if entry, s = split(s, ','); entry == "" {
+			continue
+		}
+
+		entry, weight := split(entry, ';')
+
+		// Scan the language.
+		t, err := Parse(entry)
+		if err != nil {
+			id, ok := acceptFallback[entry]
+			if !ok {
+				return nil, nil, err
+			}
+			t = Tag{lang: id}
+		}
+
+		// Scan the optional weight.
+		w := 1.0
+		if weight != "" {
+			weight = consume(weight, 'q')
+			weight = consume(weight, '=')
+			// consume returns the empty string when a token could not be
+			// consumed, resulting in an error for ParseFloat.
+			if w, err = strconv.ParseFloat(weight, 32); err != nil {
+				return nil, nil, errInvalidWeight
+			}
+			// Drop tags with a quality weight of 0.
+			if w <= 0 {
+				continue
+			}
+		}
+
+		tag = append(tag, t)
+		q = append(q, float32(w))
+	}
+	sortStable(&tagSort{tag, q})
+	return tag, q, nil
+}
+
+// consume removes a leading token c from s and returns the result or the empty
+// string if there is no such token.
+func consume(s string, c byte) string {
+	if s == "" || s[0] != c {
+		return ""
+	}
+	return strings.TrimSpace(s[1:])
+}
+
+func split(s string, c byte) (head, tail string) {
+	if i := strings.IndexByte(s, c); i >= 0 {
+		return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:])
+	}
+	return strings.TrimSpace(s), ""
+}
+
+// Add hack mapping to deal with a small number of cases that that occur
+// in Accept-Language (with reasonable frequency).
+var acceptFallback = map[string]langID{
+	"english": _en,
+	"deutsch": _de,
+	"italian": _it,
+	"french":  _fr,
+	"*":       _mul, // defined in the spec to match all languages.
+}
+
+type tagSort struct {
+	tag []Tag
+	q   []float32
+}
+
+func (s *tagSort) Len() int {
+	return len(s.q)
+}
+
+func (s *tagSort) Less(i, j int) bool {
+	return s.q[i] > s.q[j]
+}
+
+func (s *tagSort) Swap(i, j int) {
+	s.tag[i], s.tag[j] = s.tag[j], s.tag[i]
+	s.q[i], s.q[j] = s.q[j], s.q[i]
+}
diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go
new file mode 100644
index 000000000..ccdc1ff0f
--- /dev/null
+++ b/vendor/golang.org/x/text/language/tables.go
@@ -0,0 +1,3547 @@
+// This file was generated by go generate; DO NOT EDIT
+
+package language
+
+import "golang.org/x/text/internal/tag"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "30"
+
+const numLanguages = 8654
+
+const numScripts = 230
+
+const numRegions = 356
+
+type fromTo struct {
+	from uint16
+	to   uint16
+}
+
+const nonCanonicalUnd = 1191
+const (
+	_af  = 21
+	_am  = 38
+	_ar  = 57
+	_az  = 87
+	_bg  = 125
+	_bn  = 163
+	_ca  = 213
+	_cs  = 246
+	_da  = 253
+	_de  = 265
+	_el  = 305
+	_en  = 308
+	_es  = 313
+	_et  = 315
+	_fa  = 323
+	_fi  = 332
+	_fil = 334
+	_fr  = 345
+	_gu  = 413
+	_he  = 437
+	_hi  = 439
+	_hr  = 458
+	_hu  = 462
+	_hy  = 464
+	_id  = 474
+	_is  = 496
+	_it  = 497
+	_ja  = 504
+	_ka  = 520
+	_kk  = 570
+	_km  = 578
+	_kn  = 585
+	_ko  = 587
+	_ky  = 641
+	_lo  = 687
+	_lt  = 695
+	_lv  = 702
+	_mk  = 758
+	_ml  = 763
+	_mn  = 770
+	_mo  = 775
+	_mr  = 786
+	_ms  = 790
+	_mul = 797
+	_my  = 808
+	_nb  = 830
+	_ne  = 840
+	_nl  = 862
+	_no  = 870
+	_pa  = 916
+	_pl  = 938
+	_pt  = 951
+	_ro  = 979
+	_ru  = 985
+	_sh  = 1021
+	_si  = 1026
+	_sk  = 1032
+	_sl  = 1036
+	_sq  = 1063
+	_sr  = 1064
+	_sv  = 1082
+	_sw  = 1083
+	_ta  = 1094
+	_te  = 1111
+	_th  = 1121
+	_tl  = 1136
+	_tn  = 1142
+	_tr  = 1152
+	_uk  = 1188
+	_ur  = 1194
+	_uz  = 1202
+	_vi  = 1209
+	_zh  = 1311
+	_zu  = 1316
+	_jbo = 507
+	_ami = 1639
+	_bnn = 2346
+	_hak = 431
+	_tlh = 14456
+	_lb  = 652
+	_nv  = 890
+	_pwn = 12044
+	_tao = 14177
+	_tay = 14187
+	_tsu = 14651
+	_nn  = 865
+	_sfb = 13618
+	_vgt = 15690
+	_sgg = 13649
+	_cmn = 2996
+	_nan = 826
+	_hsn = 460
+)
+
+const langPrivateStart = 0x2f67
+
+const langPrivateEnd = 0x316e
+
+// lang holds an alphabetically sorted list of ISO-639 language identifiers.
+// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+// For 2-byte language identifiers, the two successive bytes have the following meaning:
+//     - if the first letter of the 2- and 3-letter ISO codes are the same:
+//       the second and third letter of the 3-letter ISO code.
+//     - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+// For 3-byte language identifiers the 4th byte is 0.
+const lang tag.Index = "" + // Size: 5280 bytes
+	"---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abr\x00abt\x00aby\x00acd\x00a" +
+	"ce\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey\x00affrag" +
+	"c\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00ajg\x00akka" +
+	"akk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00amp\x00anrga" +
+	"nc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00ape\x00apr" +
+	"\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars\x00ary\x00a" +
+	"rz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00atj\x00auy" +
+	"\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx\x00ayymayb" +
+	"\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00bba\x00bbb" +
+	"\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bcm\x00bcn" +
+	"\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00bet\x00b" +
+	"ew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn\x00bgx" +
+	"\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib\x00big" +
+	"\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn\x00bjo" +
+	"\x00bjr\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt\x00bmambmh\x00b" +
+	"mk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00bom\x00bon\x00bp" +
+	"y\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx\x00brz\x00bsosbsj" +
+	"\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00buc\x00bud\x00bug" +
+	"\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr\x00bxh\x00bye" +
+	"\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf\x00bzh\x00bzw" +
+	"\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg\x00chhachk\x00" +
+	"chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00ckl\x00cko\x00ck" +
+	"y\x00cla\x00cme\x00cooscop\x00cps\x00crrecrj\x00crk\x00crl\x00crm\x00crs" +
+	"\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymdaandad\x00daf\x00dag\x00dah" +
+	"\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00ddn\x00deeuded\x00den\x00d" +
+	"ga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia\x00dje\x00dnj\x00dob\x00doi" +
+	"\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm\x00dtp\x00dts\x00dty\x00dua" +
+	"\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00dyo\x00dyu\x00dzzodzg\x00ebu" +
+	"\x00eeweefi\x00egl\x00egy\x00eky\x00elllema\x00emi\x00enngenn\x00enq\x00" +
+	"eopoeri\x00es\x00\x05esu\x00etstetr\x00ett\x00etu\x00etx\x00euusewo\x00e" +
+	"xt\x00faasfaa\x00fab\x00fag\x00fai\x00fan\x00ffulffi\x00ffm\x00fiinfia" +
+	"\x00fil\x00fit\x00fjijflr\x00fmp\x00foaofod\x00fon\x00for\x00fpe\x00fqs" +
+	"\x00frrafrc\x00frp\x00frr\x00frs\x00fub\x00fud\x00fue\x00fuf\x00fuh\x00f" +
+	"uq\x00fur\x00fuv\x00fuy\x00fvr\x00fyrygalegaa\x00gaf\x00gag\x00gah\x00ga" +
+	"j\x00gam\x00gan\x00gaw\x00gay\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdla" +
+	"gde\x00gdn\x00gdr\x00geb\x00gej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gi" +
+	"l\x00gim\x00gjk\x00gjn\x00gju\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00" +
+	"gnrngnd\x00gng\x00god\x00gof\x00goi\x00gom\x00gon\x00gor\x00gos\x00got" +
+	"\x00grc\x00grt\x00grw\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00g" +
+	"ux\x00guz\x00gvlvgvf\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauha" +
+	"g\x00hak\x00ham\x00haw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif" +
+	"\x00hig\x00hih\x00hil\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj" +
+	"\x00hnn\x00hno\x00homohoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui" +
+	"\x00hyyehzerianaian\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd" +
+	"\x00idi\x00idu\x00ieleigboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw" +
+	"\x00ikx\x00ilo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00" +
+	"\x03iwm\x00iws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00j" +
+	"gk\x00jgo\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatka" +
+	"a\x00kab\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp" +
+	"\x00kbq\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl" +
+	"\x00kdt\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00k" +
+	"gp\x00kha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij" +
+	"\x00kiu\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klal" +
+	"kln\x00klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw" +
+	"\x00knanknp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
+	"\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
+	"rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
+	"\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
+	"us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
+	"\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
+	"\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
+	"ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
+	"d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
+	"\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
+	"\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
+	"lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
+	"w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
+	"\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
+	"\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
+	"\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
+	"min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
+	"ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
+	"e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
+	"mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
+	"us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
+	"\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
+	"\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
+	"bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
+	"\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
+	"if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
+	"dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
+	"nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
+	"\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
+	"\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
+	"opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
+	"\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
+	"\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
+	"\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
+	"ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
+	"f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
+	"rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
+	"ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
+	"\x00sah\x00saq\x00sas\x00sat\x00saz\x00sba\x00sbe\x00sbp\x00scrdsck\x00s" +
+	"cl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00sei\x00se" +
+	"s\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn\x00shu" +
+	"\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks\x00sllv" +
+	"sld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp\x00smq" +
+	"\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq\x00sou" +
+	"\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx\x00sssw" +
+	"ssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00sur\x00s" +
+	"us\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00syl\x00sy" +
+	"r\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf\x00tbg\x00" +
+	"tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelted\x00tem" +
+	"\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00thq\x00thr" +
+	"\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr\x00tkt" +
+	"\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00tog\x00" +
+	"toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssotsd\x00t" +
+	"sf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts\x00ttt" +
+	"\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00twq\x00t" +
+	"xg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli\x00umb" +
+	"\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00uvh\x00u" +
+	"vl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv\x00vls" +
+	"\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj\x00wal" +
+	"\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg\x00wib" +
+	"\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu\x00woolw" +
+	"ob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00xbi\x00xcr" +
+	"\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna\x00xnr\x00x" +
+	"og\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe\x00yam\x00yao" +
+	"\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb\x00yby\x00yer" +
+	"\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00yooryon\x00yrb" +
+	"\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw\x00zahazag\x00z" +
+	"bl\x00zdj\x00zea\x00zgh\x00zhhozia\x00zlm\x00zmi\x00zne\x00zuulzxx\x00zz" +
+	"a\x00\xff\xff\xff\xff"
+
+const langNoIndexOffset = 1319
+
+// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+// in lookup tables. The language ids for these language codes are derived directly
+// from the letters and are not consecutive.
+// Size: 2197 bytes, 2197 elements
+var langNoIndex = [2197]uint8{
+	// Entry 0 - 3F
+	0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd7, 0x3b, 0xd2,
+	0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
+	0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
+	0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
+	0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
+	0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
+	0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
+	0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
+	// Entry 40 - 7F
+	0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
+	0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
+	0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
+	0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
+	0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
+	0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
+	0xa8, 0xff, 0x1f, 0x67, 0x7f, 0xeb, 0xef, 0xce,
+	0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
+	// Entry 80 - BF
+	0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
+	0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
+	0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
+	0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
+	0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
+	0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
+	0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
+	0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
+	// Entry C0 - FF
+	0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
+	0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56,
+	0x45, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
+	0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
+	0xbc, 0x87, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
+	0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
+	0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
+	0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
+	// Entry 100 - 13F
+	0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
+	0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
+	0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
+	0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
+	0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
+	0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
+	0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
+	0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
+	// Entry 140 - 17F
+	0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16,
+	0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
+	0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
+	0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
+	0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
+	0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
+	0x00, 0x00, 0x50, 0xd5, 0x2d, 0x00, 0x64, 0x35,
+	0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
+	// Entry 180 - 1BF
+	0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
+	0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
+	0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
+	// Entry 1C0 - 1FF
+	0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
+	0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
+	0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
+	0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
+	0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7e, 0xbf,
+	// Entry 200 - 23F
+	0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
+	0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
+	0xa4, 0x45, 0x25, 0x9b, 0x02, 0xcf, 0xe0, 0xdf,
+	0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3,
+	0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d,
+	0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
+	0x21, 0x12, 0x6c, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
+	0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
+	// Entry 240 - 27F
+	0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
+	0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0,
+	0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
+	0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
+	0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
+	0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
+	0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66,
+	// Entry 280 - 2BF
+	0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
+	0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
+	0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
+	0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+	0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
+	0xe5, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
+	0x03, 0x00, 0x00, 0x00, 0xcc, 0x50, 0x40, 0x04,
+	0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
+	// Entry 2C0 - 2FF
+	0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
+	0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
+	0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
+	0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
+	0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
+	0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
+	0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
+	0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
+	// Entry 300 - 33F
+	0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
+	0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
+	0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
+	0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
+	0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
+	0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
+	0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
+	0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
+	// Entry 340 - 37F
+	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
+	0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
+	0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
+	0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
+	0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
+	0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
+	0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0xff,
+	0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
+	// Entry 380 - 3BF
+	0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
+	0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
+	0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
+	0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
+	0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
+	0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
+	0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
+	0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
+	// Entry 3C0 - 3FF
+	0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
+	0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
+	0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
+	0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
+	0x84, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
+	0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
+	0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
+	0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
+	// Entry 400 - 43F
+	0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
+	0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
+	0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
+	0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
+	0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
+	0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
+	0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
+	0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
+	// Entry 440 - 47F
+	0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
+	0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
+	0x7f, 0x4e, 0xbf, 0x8e, 0xae, 0xff, 0xee, 0xdf,
+	0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
+	0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
+	0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd,
+	0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
+	0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x04, 0x44,
+	// Entry 480 - 4BF
+	0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb,
+	0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
+	0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
+	0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
+	0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
+	0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
+	0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
+	// Entry 4C0 - 4FF
+	0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
+	0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
+	0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
+	0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
+	0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
+	0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
+	0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
+	// Entry 500 - 53F
+	0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
+	0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
+	0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
+	0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7,
+	0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
+	0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
+	0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
+	0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
+	// Entry 540 - 57F
+	0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	// Entry 580 - 5BF
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
+	0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
+	0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
+	0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
+	0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
+	0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
+	0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
+	// Entry 5C0 - 5FF
+	0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
+	0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
+	0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
+	0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
+	0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
+	0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
+	0x00, 0x1f, 0xdf, 0xf2, 0xb9, 0xff, 0xfd, 0x3f,
+	0x1f, 0x18, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe,
+	// Entry 600 - 63F
+	0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
+	0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
+	0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
+	0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
+	0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
+	0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
+	0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
+	0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
+	// Entry 640 - 67F
+	0x75, 0xc4, 0x7d, 0x81, 0x82, 0xf1, 0x57, 0x6c,
+	0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
+	0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98,
+	0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
+	0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
+	0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
+	0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
+	0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
+	// Entry 680 - 6BF
+	0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
+	0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda,
+	0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
+	0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
+	0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
+	0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
+	0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
+	0x04, 0x00, 0x10, 0x8c, 0x58, 0xd5, 0x0d, 0x0f,
+	// Entry 6C0 - 6FF
+	0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
+	0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
+	0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41,
+	0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
+	0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
+	0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
+	// Entry 700 - 73F
+	0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
+	0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
+	0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
+	0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
+	0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
+	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 740 - 77F
+	0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
+	0xa0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
+	0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
+	0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
+	0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
+	0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
+	0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
+	// Entry 780 - 7BF
+	0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
+	0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
+	0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
+	0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
+	0x78, 0x15, 0x50, 0x00, 0xa4, 0x84, 0xa9, 0x41,
+	0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
+	0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
+	0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
+	// Entry 7C0 - 7FF
+	0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42,
+	0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56,
+	0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
+	0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
+	0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
+	0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
+	0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
+	0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
+	// Entry 800 - 83F
+	0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
+	0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
+	0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
+	0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
+	0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
+	0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
+	0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
+	0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
+	// Entry 840 - 87F
+	0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
+	0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
+	0x84, 0x00, 0x23, 0xc0, 0x23, 0x24, 0x00, 0x00,
+	0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
+	0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
+	0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
+	0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
+	// Entry 880 - 8BF
+	0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
+	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
+	0x0a, 0x00, 0x80, 0x00, 0x00,
+}
+
+// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+// to 2-letter language codes that cannot be derived using the method described above.
+// Each 3-letter code is followed by its 1-byte langID.
+const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
+
+// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
+// Size: 12 bytes, 6 elements
+var altLangIndex = [6]uint16{
+	0x0278, 0x03fd, 0x01f3, 0x03dc, 0x0139, 0x0200,
+}
+
+// langAliasMap maps langIDs to their suggested replacements.
+// Size: 644 bytes, 161 elements
+var langAliasMap = [161]fromTo{
+	0:   {from: 0x81, to: 0x87},
+	1:   {from: 0x181, to: 0x1a7},
+	2:   {from: 0x1eb, to: 0x1da},
+	3:   {from: 0x1f3, to: 0x1b5},
+	4:   {from: 0x200, to: 0x508},
+	5:   {from: 0x207, to: 0x206},
+	6:   {from: 0x307, to: 0x3d3},
+	7:   {from: 0x33e, to: 0x366},
+	8:   {from: 0x3fd, to: 0x428},
+	9:   {from: 0x470, to: 0x14e},
+	10:  {from: 0x486, to: 0x447},
+	11:  {from: 0x498, to: 0x20},
+	12:  {from: 0x533, to: 0x539},
+	13:  {from: 0x584, to: 0x129},
+	14:  {from: 0x625, to: 0x1ea6},
+	15:  {from: 0x646, to: 0x427},
+	16:  {from: 0x657, to: 0x427},
+	17:  {from: 0x6e2, to: 0x39},
+	18:  {from: 0x6ed, to: 0x1d0},
+	19:  {from: 0x733, to: 0x2196},
+	20:  {from: 0x7a8, to: 0x55},
+	21:  {from: 0x7ae, to: 0x2990},
+	22:  {from: 0x7ba, to: 0x57},
+	23:  {from: 0x7db, to: 0x140},
+	24:  {from: 0x801, to: 0x59},
+	25:  {from: 0x80a, to: 0x8c},
+	26:  {from: 0x873, to: 0x805},
+	27:  {from: 0x8b8, to: 0xed8},
+	28:  {from: 0x9e4, to: 0x328},
+	29:  {from: 0xa2b, to: 0x2bc},
+	30:  {from: 0xa32, to: 0xbd},
+	31:  {from: 0xab3, to: 0x3317},
+	32:  {from: 0xb2d, to: 0x51f},
+	33:  {from: 0xb6a, to: 0x264f},
+	34:  {from: 0xb73, to: 0xbb8},
+	35:  {from: 0xb90, to: 0x444},
+	36:  {from: 0xbb1, to: 0x421e},
+	37:  {from: 0xbb4, to: 0x51f},
+	38:  {from: 0xbf3, to: 0x2d9c},
+	39:  {from: 0xc23, to: 0x3176},
+	40:  {from: 0xcae, to: 0xf0},
+	41:  {from: 0xcfd, to: 0xf6},
+	42:  {from: 0xdbd, to: 0x116},
+	43:  {from: 0xdcc, to: 0x324},
+	44:  {from: 0xded, to: 0xdf0},
+	45:  {from: 0xdf3, to: 0x526},
+	46:  {from: 0xed4, to: 0x204f},
+	47:  {from: 0xee3, to: 0x2e8f},
+	48:  {from: 0xf2e, to: 0x35e},
+	49:  {from: 0x10c5, to: 0x13b},
+	50:  {from: 0x10f9, to: 0x2c7},
+	51:  {from: 0x1195, to: 0x1e4},
+	52:  {from: 0x126e, to: 0x20},
+	53:  {from: 0x1419, to: 0x159},
+	54:  {from: 0x1465, to: 0x149},
+	55:  {from: 0x1514, to: 0xd90},
+	56:  {from: 0x1518, to: 0x387},
+	57:  {from: 0x1527, to: 0x16ba},
+	58:  {from: 0x1575, to: 0x208},
+	59:  {from: 0x1578, to: 0x109},
+	60:  {from: 0x1598, to: 0x3ca4},
+	61:  {from: 0x165f, to: 0x195},
+	62:  {from: 0x16bd, to: 0x131},
+	63:  {from: 0x16f5, to: 0x29ed},
+	64:  {from: 0x170d, to: 0x18e},
+	65:  {from: 0x171c, to: 0xf34},
+	66:  {from: 0x176f, to: 0x1519},
+	67:  {from: 0x17fe, to: 0x17ab},
+	68:  {from: 0x180b, to: 0x18e8},
+	69:  {from: 0x187f, to: 0x42c},
+	70:  {from: 0x196e, to: 0x1cf6},
+	71:  {from: 0x1a69, to: 0x2ba5},
+	72:  {from: 0x1a7f, to: 0x1f0},
+	73:  {from: 0x1b4f, to: 0x1f2},
+	74:  {from: 0x1b7b, to: 0x150a},
+	75:  {from: 0x202d, to: 0x37a6},
+	76:  {from: 0x2032, to: 0x20d2},
+	77:  {from: 0x204f, to: 0x302},
+	78:  {from: 0x20d8, to: 0x26b},
+	79:  {from: 0x20e3, to: 0x25a},
+	80:  {from: 0x20e7, to: 0x225},
+	81:  {from: 0x20ee, to: 0x24d},
+	82:  {from: 0x2104, to: 0x21e0},
+	83:  {from: 0x212a, to: 0x274},
+	84:  {from: 0x218e, to: 0x11d},
+	85:  {from: 0x21c3, to: 0x1556},
+	86:  {from: 0x21db, to: 0x4fa},
+	87:  {from: 0x21e9, to: 0x495},
+	88:  {from: 0x2222, to: 0x11d},
+	89:  {from: 0x222c, to: 0x11d},
+	90:  {from: 0x2257, to: 0x91f},
+	91:  {from: 0x230b, to: 0x321b},
+	92:  {from: 0x2377, to: 0x335a},
+	93:  {from: 0x2467, to: 0x2be},
+	94:  {from: 0x24d9, to: 0x2f6},
+	95:  {from: 0x24e5, to: 0x2f1},
+	96:  {from: 0x24ef, to: 0x316},
+	97:  {from: 0x2545, to: 0xb50},
+	98:  {from: 0x259e, to: 0xe0},
+	99:  {from: 0x2633, to: 0x2c7},
+	100: {from: 0x26be, to: 0x26a9},
+	101: {from: 0x26ee, to: 0x3bf},
+	102: {from: 0x271c, to: 0x3ca4},
+	103: {from: 0x275a, to: 0x26a9},
+	104: {from: 0x277e, to: 0x434d},
+	105: {from: 0x28e4, to: 0x282c},
+	106: {from: 0x2909, to: 0x348},
+	107: {from: 0x297b, to: 0x2d9c},
+	108: {from: 0x2b0f, to: 0x384},
+	109: {from: 0x2bf1, to: 0x38c},
+	110: {from: 0x2c34, to: 0x3ca4},
+	111: {from: 0x2cf1, to: 0x3b5},
+	112: {from: 0x2d08, to: 0x58c},
+	113: {from: 0x2d3c, to: 0x143},
+	114: {from: 0x2d3d, to: 0x143},
+	115: {from: 0x2df4, to: 0x2e8},
+	116: {from: 0x2dfd, to: 0x19c1},
+	117: {from: 0x2e0f, to: 0x2d8a},
+	118: {from: 0x2e16, to: 0x289},
+	119: {from: 0x2e49, to: 0x7c},
+	120: {from: 0x2e5a, to: 0x2277},
+	121: {from: 0x2e95, to: 0x2e90},
+	122: {from: 0x2ee4, to: 0x2ecc},
+	123: {from: 0x3188, to: 0x3bb},
+	124: {from: 0x335b, to: 0x3383},
+	125: {from: 0x341f, to: 0x3d3},
+	126: {from: 0x34e3, to: 0x18c5},
+	127: {from: 0x35db, to: 0x408},
+	128: {from: 0x364d, to: 0x23e},
+	129: {from: 0x366b, to: 0x3ea},
+	130: {from: 0x36f2, to: 0x43b},
+	131: {from: 0x37b5, to: 0x11d},
+	132: {from: 0x380b, to: 0x38e7},
+	133: {from: 0x3820, to: 0x2c90},
+	134: {from: 0x3824, to: 0xa7},
+	135: {from: 0x3827, to: 0x321d},
+	136: {from: 0x3861, to: 0x399b},
+	137: {from: 0x3887, to: 0x3fb5},
+	138: {from: 0x389a, to: 0x39cc},
+	139: {from: 0x38a9, to: 0x1f99},
+	140: {from: 0x38aa, to: 0x2e8f},
+	141: {from: 0x3951, to: 0x474},
+	142: {from: 0x3b43, to: 0xd86},
+	143: {from: 0x3b6d, to: 0x132},
+	144: {from: 0x3c8e, to: 0x4b2},
+	145: {from: 0x3fb2, to: 0xfc},
+	146: {from: 0x41fd, to: 0xa86},
+	147: {from: 0x42b3, to: 0x568},
+	148: {from: 0x42ee, to: 0x3f55},
+	149: {from: 0x436d, to: 0x251},
+	150: {from: 0x43c0, to: 0x36c0},
+	151: {from: 0x43c2, to: 0x10b},
+	152: {from: 0x44a4, to: 0x3317},
+	153: {from: 0x44d8, to: 0x508},
+	154: {from: 0x45bf, to: 0x23fe},
+	155: {from: 0x45d2, to: 0x26d1},
+	156: {from: 0x4605, to: 0x48a3},
+	157: {from: 0x46a3, to: 0x4695},
+	158: {from: 0x4733, to: 0x473a},
+	159: {from: 0x490b, to: 0x316},
+	160: {from: 0x499c, to: 0x519},
+}
+
+// Size: 161 bytes, 161 elements
+var langAliasTypes = [161]langAliasType{
+	// Entry 0 - 3F
+	1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
+	1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0,
+	2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0,
+	2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0,
+	// Entry 40 - 7F
+	1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 1, 1, 1,
+	1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 2, 2,
+	2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, 0, 1,
+	0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 2,
+	// Entry 80 - BF
+	1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, 0,
+	1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, 1,
+	1,
+}
+
+const (
+	_Latn = 82
+	_Hani = 50
+	_Hans = 52
+	_Hant = 53
+	_Qaaa = 131
+	_Qaai = 139
+	_Qabx = 180
+	_Zinh = 224
+	_Zyyy = 229
+	_Zzzz = 230
+)
+
+// script is an alphabetically sorted list of ISO 15924 codes. The index
+// of the script in the string, divided by 4, is the internal scriptID.
+const script tag.Index = "" + // Size: 928 bytes
+	"----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
+	"BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCprtCyrlCyrsDevaDsrtDuplEgyd" +
+	"EgyhEgypElbaEthiGeokGeorGlagGothGranGrekGujrGuruHanbHangHaniHanoHansHant" +
+	"HatrHebrHiraHluwHmngHrktHungIndsItalJamoJavaJpanJurcKaliKanaKharKhmrKhoj" +
+	"KitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepcLimbLinaLinbLisuLoma" +
+	"LyciLydiMahjMandManiMarcMayaMendMercMeroMlymModiMongMoonMrooMteiMultMymr" +
+	"NarbNbatNewaNkgbNkooNshuOgamOlckOrkhOryaOsgeOsmaPalmPaucPermPhagPhliPhlp" +
+	"PhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" +
+	"QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" +
+	"QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" +
+	"QabxRjngRoroRunrSamrSaraSarbSaurSgnwShawShrdSiddSindSinhSoraSundSyloSyrc" +
+	"SyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglgThaaThaiTibtTirh" +
+	"UgarVaiiVispWaraWoleXpeoXsuxYiiiZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff" +
+	"\xff"
+
+// suppressScript is an index from langID to the dominant script for that language,
+// if it exists.  If a script is given, it should be suppressed from the language tag.
+// Size: 1319 bytes, 1319 elements
+var suppressScript = [1319]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x27, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 40 - 7F
+	0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x1e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00,
+	// Entry 80 - BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry C0 - FF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x52, 0x52, 0x00, 0x00,
+	// Entry 100 - 13F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00,
+	0x00, 0xd6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x2d, 0x00, 0x00, 0x52, 0x00, 0x00, 0x52,
+	0x00, 0x52, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
+	// Entry 140 - 17F
+	0x52, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
+	0x52, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x52, 0x00, 0x00, 0x52, 0x52, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x52, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 180 - 1BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x52, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x52, 0x2e, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x37, 0x00, 0x20,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 1C0 - 1FF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x52, 0x52, 0x00, 0x52, 0x52, 0x00,
+	0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
+	0x52, 0x52, 0x00, 0x37, 0x00, 0x00, 0x00, 0x00,
+	0x41, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 200 - 23F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x29, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x1e, 0x00, 0x00, 0x52, 0x00, 0x00,
+	// Entry 240 - 27F
+	0x00, 0x00, 0x46, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x4a, 0x00, 0x4b, 0x00, 0x20, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 280 - 2BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x4f,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
+	// Entry 2C0 - 2FF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00,
+	0x00, 0x00, 0x00, 0x64, 0x00, 0x00, 0x00, 0x00,
+	// Entry 300 - 33F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x52, 0x52,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x6b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
+	// Entry 340 - 37F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x52,
+	0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
+	0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x70, 0x52, 0x00, 0x00,
+	0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
+	// Entry 380 - 3BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
+	0x00, 0x00, 0x00, 0x00, 0x75, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x2f, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x52,
+	0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
+	// Entry 3C0 - 3FF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
+	0x52, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x1e, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 400 - 43F
+	0x00, 0x00, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
+	0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
+	0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x52, 0x52, 0x00, 0x00, 0x00, 0x00,
+	// Entry 440 - 47F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xcd, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xd0,
+	0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0xd5, 0x00, 0x00, 0x00, 0x27, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
+	0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x52, 0x00,
+	0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
+	// Entry 480 - 4BF
+	0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
+	0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 4C0 - 4FF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 500 - 53F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x37, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
+}
+
+const (
+	_001 = 1
+	_419 = 30
+	_BR  = 64
+	_CA  = 72
+	_ES  = 109
+	_GB  = 122
+	_MD  = 187
+	_PT  = 237
+	_UK  = 305
+	_US  = 308
+	_ZZ  = 356
+	_XA  = 322
+	_XC  = 324
+	_XK  = 332
+)
+
+// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+// the UN.M49 codes used for groups.)
+const isoRegionOffset = 31
+
+// regionTypes defines the status of a region for various standards.
+// Size: 357 bytes, 357 elements
+var regionTypes = [357]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry 40 - 7F
+	0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, 0x00,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
+	0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
+	0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry 80 - BF
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry C0 - FF
+	0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
+	0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06,
+	0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
+	0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	// Entry 100 - 13F
+	0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry 140 - 17F
+	0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, 0x04,
+	0x06, 0x06, 0x04, 0x06, 0x05,
+}
+
+// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+// Each 2-letter codes is followed by two bytes with the following meaning:
+//     - [A-Z}{2}: the first letter of the 2-letter code plus these two
+//                 letters form the 3-letter ISO code.
+//     - 0, n:     index into altRegionISO3.
+const regionISO tag.Index = "" + // Size: 1308 bytes
+	"AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
+	"AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
+	"BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
+	"CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
+	"HYDZZAEA  ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ  FIINFJJIFKLKFMSMFORO" +
+	"FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
+	"RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC  IDDNIERLILSR" +
+	"IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
+	"\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
+	"LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
+	"MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
+	"NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
+	"\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
+	"QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
+	"SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
+	"SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
+	"UVTWWNTZZAUAKRUGGAUK  UMMIUN  USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
+	"UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
+	"OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
+	"ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
+
+// altRegionISO3 holds a list of 3-letter region codes that cannot be
+// mapped to 2-letter codes using the default algorithm. This is a short list.
+const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
+
+// altRegionIDs holds a list of regionIDs the positions of which match those
+// of the 3-letter ISO codes in altRegionISO3.
+// Size: 22 bytes, 11 elements
+var altRegionIDs = [11]uint16{
+	0x0056, 0x006f, 0x0087, 0x00a7, 0x00a9, 0x00ac, 0x00e9, 0x0104,
+	0x0120, 0x015e, 0x00db,
+}
+
+// Size: 80 bytes, 20 elements
+var regionOldMap = [20]fromTo{
+	0:  {from: 0x43, to: 0xc3},
+	1:  {from: 0x57, to: 0xa6},
+	2:  {from: 0x5e, to: 0x5f},
+	3:  {from: 0x65, to: 0x3a},
+	4:  {from: 0x78, to: 0x77},
+	5:  {from: 0x92, to: 0x36},
+	6:  {from: 0xa2, to: 0x132},
+	7:  {from: 0xc0, to: 0x132},
+	8:  {from: 0xd6, to: 0x13e},
+	9:  {from: 0xdb, to: 0x2a},
+	10: {from: 0xee, to: 0x132},
+	11: {from: 0xf1, to: 0xe1},
+	12: {from: 0xfb, to: 0x6f},
+	13: {from: 0x102, to: 0x163},
+	14: {from: 0x129, to: 0x125},
+	15: {from: 0x131, to: 0x7a},
+	16: {from: 0x139, to: 0x13d},
+	17: {from: 0x140, to: 0x132},
+	18: {from: 0x15c, to: 0x15d},
+	19: {from: 0x162, to: 0x4a},
+}
+
+// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+// codes indicating collections of regions.
+// Size: 714 bytes, 357 elements
+var m49 = [357]int16{
+	// Entry 0 - 3F
+	0, 1, 2, 3, 5, 9, 11, 13,
+	14, 15, 17, 18, 19, 21, 29, 30,
+	34, 35, 39, 53, 54, 57, 61, 142,
+	143, 145, 150, 151, 154, 155, 419, 958,
+	0, 20, 784, 4, 28, 660, 8, 51,
+	530, 24, 10, 32, 16, 40, 36, 533,
+	248, 31, 70, 52, 50, 56, 854, 100,
+	48, 108, 204, 652, 60, 96, 68, 535,
+	// Entry 40 - 7F
+	76, 44, 64, 104, 74, 72, 112, 84,
+	124, 166, 180, 140, 178, 756, 384, 184,
+	152, 120, 156, 170, 0, 188, 891, 296,
+	192, 132, 531, 162, 196, 203, 278, 276,
+	0, 262, 208, 212, 214, 204, 12, 0,
+	218, 233, 818, 732, 232, 724, 231, 967,
+	0, 246, 242, 238, 583, 234, 0, 250,
+	249, 266, 826, 308, 268, 254, 831, 288,
+	// Entry 80 - BF
+	292, 304, 270, 324, 312, 226, 300, 239,
+	320, 316, 624, 328, 344, 334, 340, 191,
+	332, 348, 854, 0, 360, 372, 376, 833,
+	356, 86, 368, 364, 352, 380, 832, 388,
+	400, 392, 581, 404, 417, 116, 296, 174,
+	659, 408, 410, 414, 136, 398, 418, 422,
+	662, 438, 144, 430, 426, 440, 442, 428,
+	434, 504, 492, 498, 499, 663, 450, 584,
+	// Entry C0 - FF
+	581, 807, 466, 104, 496, 446, 580, 474,
+	478, 500, 470, 480, 462, 454, 484, 458,
+	508, 516, 540, 562, 574, 566, 548, 558,
+	528, 578, 524, 10, 520, 536, 570, 554,
+	512, 591, 0, 604, 258, 598, 608, 586,
+	616, 666, 612, 630, 275, 620, 581, 585,
+	600, 591, 634, 959, 960, 961, 962, 963,
+	964, 965, 966, 967, 968, 969, 970, 971,
+	// Entry 100 - 13F
+	972, 638, 716, 642, 688, 643, 646, 682,
+	90, 690, 729, 752, 702, 654, 705, 744,
+	703, 694, 674, 686, 706, 740, 728, 678,
+	810, 222, 534, 760, 748, 0, 796, 148,
+	260, 768, 764, 762, 772, 626, 795, 788,
+	776, 626, 792, 780, 798, 158, 834, 804,
+	800, 826, 581, 0, 840, 858, 860, 336,
+	670, 704, 862, 92, 850, 704, 548, 876,
+	// Entry 140 - 17F
+	581, 882, 973, 974, 975, 976, 977, 978,
+	979, 980, 981, 982, 983, 984, 985, 986,
+	987, 988, 989, 990, 991, 992, 993, 994,
+	995, 996, 997, 998, 720, 887, 175, 891,
+	710, 894, 180, 716, 999,
+}
+
+// m49Index gives indexes into fromM49 based on the three most significant bits
+// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+//    fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+// The region code is stored in the 9 lsb of the indexed value.
+// Size: 18 bytes, 9 elements
+var m49Index = [9]int16{
+	0, 59, 107, 142, 180, 219, 258, 290,
+	332,
+}
+
+// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
+// Size: 664 bytes, 332 elements
+var fromM49 = [332]uint16{
+	// Entry 0 - 3F
+	0x0201, 0x0402, 0x0603, 0x0823, 0x0a04, 0x1026, 0x1205, 0x142a,
+	0x1606, 0x1866, 0x1a07, 0x1c08, 0x1e09, 0x202c, 0x220a, 0x240b,
+	0x260c, 0x2821, 0x2a0d, 0x3029, 0x3824, 0x3a0e, 0x3c0f, 0x3e31,
+	0x402b, 0x4410, 0x4611, 0x482e, 0x4e12, 0x502d, 0x5841, 0x6038,
+	0x6434, 0x6627, 0x6833, 0x6a13, 0x6c14, 0x7035, 0x7215, 0x783c,
+	0x7a16, 0x8042, 0x883e, 0x8c32, 0x9045, 0x9444, 0x9840, 0xa847,
+	0xac99, 0xb508, 0xb93b, 0xc03d, 0xc837, 0xd0c3, 0xd839, 0xe046,
+	0xe8a5, 0xf051, 0xf848, 0x0859, 0x10ac, 0x184b, 0x1c17, 0x1e18,
+	// Entry 40 - 7F
+	0x20b2, 0x2219, 0x291f, 0x2c1a, 0x2e1b, 0x3050, 0x341c, 0x361d,
+	0x3852, 0x3d2d, 0x445b, 0x4c49, 0x5453, 0x5ca7, 0x5f5e, 0x644c,
+	0x684a, 0x704f, 0x7855, 0x7e8f, 0x8058, 0x885c, 0x965d, 0x983a,
+	0xa062, 0xa863, 0xac64, 0xb468, 0xbd19, 0xc485, 0xcc6e, 0xce6e,
+	0xd06c, 0xd269, 0xd475, 0xdc73, 0xde87, 0xe472, 0xec71, 0xf030,
+	0xf278, 0xf477, 0xfc7d, 0x04e4, 0x0920, 0x0c61, 0x1479, 0x187c,
+	0x1c82, 0x26ec, 0x285f, 0x2c5e, 0x305f, 0x407f, 0x4880, 0x50a6,
+	0x5886, 0x6081, 0x687b, 0x7084, 0x7889, 0x8088, 0x8883, 0x908b,
+	// Entry 80 - BF
+	0x9890, 0x9c8d, 0xa137, 0xa88e, 0xb08c, 0xb891, 0xc09c, 0xc898,
+	0xd094, 0xd89b, 0xe09a, 0xe895, 0xf096, 0xf89d, 0x004e, 0x089f,
+	0x10a1, 0x1cad, 0x20a0, 0x28a3, 0x30a9, 0x34aa, 0x3cab, 0x42a4,
+	0x44ae, 0x461e, 0x4caf, 0x54b4, 0x58b7, 0x5cb3, 0x64b8, 0x6cb1,
+	0x70b5, 0x74b6, 0x7cc5, 0x84be, 0x8ccd, 0x94cf, 0x9ccc, 0xa4c2,
+	0xacca, 0xb4c7, 0xbcc8, 0xc0cb, 0xc8ce, 0xd8ba, 0xe0c4, 0xe4bb,
+	0xe6bc, 0xe8c9, 0xf0b9, 0xf8d0, 0x00e0, 0x08d1, 0x10dc, 0x18da,
+	0x20d8, 0x2428, 0x265a, 0x2a2f, 0x2d1a, 0x2e3f, 0x30dd, 0x38d2,
+	// Entry C0 - FF
+	0x493e, 0x54df, 0x5cd7, 0x64d3, 0x6cd5, 0x74de, 0x7cd4, 0x84d9,
+	0x88c6, 0x8b32, 0x8e74, 0x90bf, 0x92ef, 0x94e7, 0x9ee1, 0xace5,
+	0xb0f0, 0xb8e3, 0xc0e6, 0xc8ea, 0xd0e8, 0xd8ed, 0xe08a, 0xe525,
+	0xeceb, 0xf4f2, 0xfd01, 0x0503, 0x0705, 0x0d06, 0x183b, 0x1d0d,
+	0x26a8, 0x2825, 0x2cb0, 0x2ebd, 0x34e9, 0x3d38, 0x4512, 0x4d17,
+	0x5507, 0x5d13, 0x6104, 0x6509, 0x6d11, 0x7d0c, 0x7f10, 0x813d,
+	0x830e, 0x8514, 0x8d60, 0x9963, 0xa15c, 0xa86d, 0xb116, 0xb30a,
+	0xb86b, 0xc10a, 0xc915, 0xd10f, 0xd91c, 0xe10b, 0xe84d, 0xf11b,
+	// Entry 100 - 13F
+	0xf523, 0xf922, 0x0121, 0x0924, 0x1128, 0x192b, 0x2022, 0x2927,
+	0x312a, 0x3726, 0x391e, 0x3d2c, 0x4130, 0x492f, 0x4ec1, 0x5518,
+	0x646a, 0x747a, 0x7e7e, 0x809e, 0x8297, 0x852e, 0x9134, 0xa53c,
+	0xac36, 0xb535, 0xb936, 0xbd3a, 0xd93f, 0xe541, 0xed5d, 0xef5d,
+	0xf656, 0xfd61, 0x7c1f, 0x7ef3, 0x80f4, 0x82f5, 0x84f6, 0x86f7,
+	0x88f8, 0x8af9, 0x8cfa, 0x8e6f, 0x90fc, 0x92fd, 0x94fe, 0x96ff,
+	0x9900, 0x9b42, 0x9d43, 0x9f44, 0xa145, 0xa346, 0xa547, 0xa748,
+	0xa949, 0xab4a, 0xad4b, 0xaf4c, 0xb14d, 0xb34e, 0xb54f, 0xb750,
+	// Entry 140 - 17F
+	0xb951, 0xbb52, 0xbd53, 0xbf54, 0xc155, 0xc356, 0xc557, 0xc758,
+	0xc959, 0xcb5a, 0xcd5b, 0xcf64,
+}
+
+// Size: 1463 bytes
+var variantIndex = map[string]uint8{
+	"1606nict": 0x0,
+	"1694acad": 0x1,
+	"1901":     0x2,
+	"1959acad": 0x3,
+	"1994":     0x45,
+	"1996":     0x4,
+	"abl1943":  0x5,
+	"alalc97":  0x47,
+	"aluku":    0x6,
+	"ao1990":   0x7,
+	"arevela":  0x8,
+	"arevmda":  0x9,
+	"baku1926": 0xa,
+	"balanka":  0xb,
+	"barla":    0xc,
+	"basiceng": 0xd,
+	"bauddha":  0xe,
+	"biscayan": 0xf,
+	"biske":    0x40,
+	"bohoric":  0x10,
+	"boont":    0x11,
+	"colb1945": 0x12,
+	"cornu":    0x13,
+	"dajnko":   0x14,
+	"ekavsk":   0x15,
+	"emodeng":  0x16,
+	"fonipa":   0x48,
+	"fonnapa":  0x49,
+	"fonupa":   0x4a,
+	"fonxsamp": 0x4b,
+	"hepburn":  0x17,
+	"heploc":   0x46,
+	"hognorsk": 0x18,
+	"ijekavsk": 0x19,
+	"itihasa":  0x1a,
+	"jauer":    0x1b,
+	"jyutping": 0x1c,
+	"kkcor":    0x1d,
+	"kociewie": 0x1e,
+	"kscor":    0x1f,
+	"laukika":  0x20,
+	"lipaw":    0x41,
+	"luna1918": 0x21,
+	"metelko":  0x22,
+	"monoton":  0x23,
+	"ndyuka":   0x24,
+	"nedis":    0x25,
+	"newfound": 0x26,
+	"njiva":    0x42,
+	"nulik":    0x27,
+	"osojs":    0x43,
+	"oxendict": 0x28,
+	"pamaka":   0x29,
+	"petr1708": 0x2a,
+	"pinyin":   0x2b,
+	"polyton":  0x2c,
+	"puter":    0x2d,
+	"rigik":    0x2e,
+	"rozaj":    0x2f,
+	"rumgr":    0x30,
+	"scotland": 0x31,
+	"scouse":   0x32,
+	"simple":   0x4c,
+	"solba":    0x44,
+	"sotav":    0x33,
+	"surmiran": 0x34,
+	"sursilv":  0x35,
+	"sutsilv":  0x36,
+	"tarask":   0x37,
+	"uccor":    0x38,
+	"ucrcor":   0x39,
+	"ulster":   0x3a,
+	"unifon":   0x3b,
+	"vaidika":  0x3c,
+	"valencia": 0x3d,
+	"vallader": 0x3e,
+	"wadegile": 0x3f,
+}
+
+// variantNumSpecialized is the number of specialized variants in variants.
+const variantNumSpecialized = 71
+
+// nRegionGroups is the number of region groups.
+const nRegionGroups = 32
+
+type likelyLangRegion struct {
+	lang   uint16
+	region uint16
+}
+
+// likelyScript is a lookup table, indexed by scriptID, for the most likely
+// languages and regions given a script.
+// Size: 928 bytes, 232 elements
+var likelyScript = [232]likelyLangRegion{
+	1:   {lang: 0x149, region: 0x83},
+	3:   {lang: 0x299, region: 0x105},
+	4:   {lang: 0x1e, region: 0x98},
+	5:   {lang: 0x39, region: 0x6a},
+	7:   {lang: 0x3a, region: 0x9b},
+	8:   {lang: 0x1d0, region: 0x27},
+	9:   {lang: 0x12, region: 0x9b},
+	10:  {lang: 0x5a, region: 0x94},
+	11:  {lang: 0x5f, region: 0x51},
+	12:  {lang: 0xb7, region: 0xb3},
+	13:  {lang: 0x62, region: 0x94},
+	14:  {lang: 0xa3, region: 0x34},
+	15:  {lang: 0x3e0, region: 0x98},
+	17:  {lang: 0x51f, region: 0x12d},
+	18:  {lang: 0x3a8, region: 0x98},
+	19:  {lang: 0x159, region: 0x77},
+	20:  {lang: 0xc0, region: 0x94},
+	21:  {lang: 0x9b, region: 0xe6},
+	22:  {lang: 0xd9, region: 0x34},
+	23:  {lang: 0xf0, region: 0x48},
+	24:  {lang: 0x4e6, region: 0x12a},
+	25:  {lang: 0xe5, region: 0x13d},
+	26:  {lang: 0xe3, region: 0x134},
+	28:  {lang: 0xee, region: 0x6a},
+	29:  {lang: 0x199, region: 0x5c},
+	30:  {lang: 0x3d9, region: 0x105},
+	32:  {lang: 0x1b7, region: 0x98},
+	34:  {lang: 0x159, region: 0x77},
+	37:  {lang: 0x12f, region: 0x6a},
+	38:  {lang: 0x427, region: 0x26},
+	39:  {lang: 0x26, region: 0x6e},
+	41:  {lang: 0x208, region: 0x7c},
+	42:  {lang: 0xfa, region: 0x37},
+	43:  {lang: 0x198, region: 0x12f},
+	44:  {lang: 0x3e0, region: 0x98},
+	45:  {lang: 0x131, region: 0x86},
+	46:  {lang: 0x19d, region: 0x98},
+	47:  {lang: 0x394, region: 0x98},
+	48:  {lang: 0x51f, region: 0x12d},
+	49:  {lang: 0x24b, region: 0xaa},
+	50:  {lang: 0x51f, region: 0x52},
+	51:  {lang: 0x1c4, region: 0xe6},
+	52:  {lang: 0x51f, region: 0x52},
+	53:  {lang: 0x51f, region: 0x12d},
+	54:  {lang: 0x2f4, region: 0x9a},
+	55:  {lang: 0x1b5, region: 0x96},
+	56:  {lang: 0x1f8, region: 0xa1},
+	57:  {lang: 0x1be, region: 0x12a},
+	58:  {lang: 0x1c3, region: 0xae},
+	60:  {lang: 0x1ce, region: 0x91},
+	62:  {lang: 0x13d, region: 0x9d},
+	63:  {lang: 0x24b, region: 0xaa},
+	64:  {lang: 0x206, region: 0x94},
+	65:  {lang: 0x1f8, region: 0xa1},
+	67:  {lang: 0x130, region: 0xc3},
+	68:  {lang: 0x1f8, region: 0xa1},
+	69:  {lang: 0x3b2, region: 0xe7},
+	70:  {lang: 0x242, region: 0xa5},
+	71:  {lang: 0x3f0, region: 0x98},
+	74:  {lang: 0x249, region: 0x98},
+	75:  {lang: 0x24b, region: 0xaa},
+	77:  {lang: 0x87, region: 0x98},
+	78:  {lang: 0x367, region: 0x122},
+	79:  {lang: 0x2af, region: 0xae},
+	84:  {lang: 0x296, region: 0x98},
+	85:  {lang: 0x29f, region: 0x98},
+	86:  {lang: 0x286, region: 0x86},
+	87:  {lang: 0x199, region: 0x86},
+	88:  {lang: 0x2a3, region: 0x52},
+	90:  {lang: 0x4ea, region: 0x12a},
+	91:  {lang: 0x4eb, region: 0x12a},
+	92:  {lang: 0x1b7, region: 0x98},
+	93:  {lang: 0x32e, region: 0x9b},
+	94:  {lang: 0x4ed, region: 0x52},
+	95:  {lang: 0xa7, region: 0x52},
+	97:  {lang: 0x2df, region: 0x111},
+	98:  {lang: 0x4ee, region: 0x10a},
+	99:  {lang: 0x4ee, region: 0x10a},
+	100: {lang: 0x2fb, region: 0x98},
+	101: {lang: 0x312, region: 0x98},
+	102: {lang: 0x302, region: 0x52},
+	104: {lang: 0x315, region: 0x34},
+	105: {lang: 0x305, region: 0x98},
+	106: {lang: 0x40a, region: 0xe7},
+	107: {lang: 0x328, region: 0xc3},
+	108: {lang: 0x4ef, region: 0x107},
+	109: {lang: 0x3a, region: 0xa0},
+	110: {lang: 0x34a, region: 0xda},
+	112: {lang: 0x2c7, region: 0x83},
+	114: {lang: 0x3f9, region: 0x95},
+	115: {lang: 0x3e5, region: 0x98},
+	116: {lang: 0x392, region: 0xc4},
+	117: {lang: 0x38c, region: 0x98},
+	118: {lang: 0x390, region: 0x134},
+	119: {lang: 0x41f, region: 0x114},
+	120: {lang: 0x3a, region: 0x11b},
+	121: {lang: 0xf9, region: 0xc3},
+	122: {lang: 0x274, region: 0x105},
+	123: {lang: 0x2c0, region: 0x52},
+	124: {lang: 0x396, region: 0x9b},
+	125: {lang: 0x396, region: 0x52},
+	127: {lang: 0x3a4, region: 0xaf},
+	129: {lang: 0x1bf, region: 0x52},
+	130: {lang: 0x4f3, region: 0x9b},
+	181: {lang: 0x3c2, region: 0x94},
+	183: {lang: 0x369, region: 0x10b},
+	184: {lang: 0x416, region: 0x96},
+	186: {lang: 0x4f5, region: 0x15d},
+	187: {lang: 0x3e6, region: 0x98},
+	188: {lang: 0x44, region: 0x134},
+	189: {lang: 0x134, region: 0x7a},
+	190: {lang: 0x3e0, region: 0x98},
+	191: {lang: 0x3e0, region: 0x98},
+	192: {lang: 0x3f0, region: 0x98},
+	193: {lang: 0x402, region: 0xb2},
+	194: {lang: 0x429, region: 0x98},
+	195: {lang: 0x434, region: 0x94},
+	196: {lang: 0x443, region: 0x34},
+	197: {lang: 0x444, region: 0x9a},
+	201: {lang: 0x450, region: 0xe6},
+	202: {lang: 0x116, region: 0x98},
+	203: {lang: 0x454, region: 0x52},
+	204: {lang: 0x22a, region: 0x52},
+	205: {lang: 0x446, region: 0x98},
+	206: {lang: 0x49b, region: 0x52},
+	207: {lang: 0x9d, region: 0x13d},
+	208: {lang: 0x457, region: 0x98},
+	210: {lang: 0x51e, region: 0xb9},
+	211: {lang: 0x14e, region: 0xe6},
+	212: {lang: 0x124, region: 0xcc},
+	213: {lang: 0x461, region: 0x122},
+	214: {lang: 0xa7, region: 0x52},
+	215: {lang: 0x2c5, region: 0x98},
+	216: {lang: 0x4a3, region: 0x11b},
+	217: {lang: 0x4b4, region: 0xb3},
+	219: {lang: 0x1c7, region: 0x98},
+	221: {lang: 0x3a0, region: 0x9b},
+	222: {lang: 0x21, region: 0x9a},
+	223: {lang: 0x1e2, region: 0x52},
+}
+
+type likelyScriptRegion struct {
+	region uint16
+	script uint8
+	flags  uint8
+}
+
+// likelyLang is a lookup table, indexed by langID, for the most likely
+// scripts and regions given incomplete information. If more entries exist for a
+// given language, region and script are the index and size respectively
+// of the list in likelyLangList.
+// Size: 5276 bytes, 1319 elements
+var likelyLang = [1319]likelyScriptRegion{
+	0:    {region: 0x134, script: 0x52, flags: 0x0},
+	1:    {region: 0x6e, script: 0x52, flags: 0x0},
+	2:    {region: 0x164, script: 0x52, flags: 0x0},
+	3:    {region: 0x164, script: 0x52, flags: 0x0},
+	4:    {region: 0x164, script: 0x52, flags: 0x0},
+	5:    {region: 0x7c, script: 0x1e, flags: 0x0},
+	6:    {region: 0x164, script: 0x52, flags: 0x0},
+	7:    {region: 0x7f, script: 0x52, flags: 0x0},
+	8:    {region: 0x164, script: 0x52, flags: 0x0},
+	9:    {region: 0x164, script: 0x52, flags: 0x0},
+	10:   {region: 0x164, script: 0x52, flags: 0x0},
+	11:   {region: 0x94, script: 0x52, flags: 0x0},
+	12:   {region: 0x130, script: 0x52, flags: 0x0},
+	13:   {region: 0x7f, script: 0x52, flags: 0x0},
+	14:   {region: 0x164, script: 0x52, flags: 0x0},
+	15:   {region: 0x164, script: 0x52, flags: 0x0},
+	16:   {region: 0x105, script: 0x1e, flags: 0x0},
+	17:   {region: 0x164, script: 0x52, flags: 0x0},
+	18:   {region: 0x9b, script: 0x9, flags: 0x0},
+	19:   {region: 0x127, script: 0x5, flags: 0x0},
+	20:   {region: 0x164, script: 0x52, flags: 0x0},
+	21:   {region: 0x160, script: 0x52, flags: 0x0},
+	22:   {region: 0x164, script: 0x52, flags: 0x0},
+	23:   {region: 0x164, script: 0x52, flags: 0x0},
+	24:   {region: 0x164, script: 0x52, flags: 0x0},
+	25:   {region: 0x164, script: 0x52, flags: 0x0},
+	26:   {region: 0x164, script: 0x52, flags: 0x0},
+	27:   {region: 0x51, script: 0x52, flags: 0x0},
+	28:   {region: 0x164, script: 0x52, flags: 0x0},
+	29:   {region: 0x164, script: 0x52, flags: 0x0},
+	30:   {region: 0x98, script: 0x4, flags: 0x0},
+	31:   {region: 0x164, script: 0x52, flags: 0x0},
+	32:   {region: 0x7f, script: 0x52, flags: 0x0},
+	33:   {region: 0x9a, script: 0xde, flags: 0x0},
+	34:   {region: 0x164, script: 0x52, flags: 0x0},
+	35:   {region: 0x164, script: 0x52, flags: 0x0},
+	36:   {region: 0x14c, script: 0x52, flags: 0x0},
+	37:   {region: 0x105, script: 0x1e, flags: 0x0},
+	38:   {region: 0x6e, script: 0x27, flags: 0x0},
+	39:   {region: 0x164, script: 0x52, flags: 0x0},
+	40:   {region: 0x164, script: 0x52, flags: 0x0},
+	41:   {region: 0xd5, script: 0x52, flags: 0x0},
+	42:   {region: 0x164, script: 0x52, flags: 0x0},
+	44:   {region: 0x164, script: 0x52, flags: 0x0},
+	45:   {region: 0x164, script: 0x52, flags: 0x0},
+	46:   {region: 0x164, script: 0x52, flags: 0x0},
+	47:   {region: 0x164, script: 0x52, flags: 0x0},
+	48:   {region: 0x164, script: 0x52, flags: 0x0},
+	49:   {region: 0x164, script: 0x52, flags: 0x0},
+	50:   {region: 0x94, script: 0x52, flags: 0x0},
+	51:   {region: 0x164, script: 0x5, flags: 0x0},
+	52:   {region: 0x121, script: 0x5, flags: 0x0},
+	53:   {region: 0x164, script: 0x52, flags: 0x0},
+	54:   {region: 0x164, script: 0x52, flags: 0x0},
+	55:   {region: 0x164, script: 0x52, flags: 0x0},
+	56:   {region: 0x164, script: 0x52, flags: 0x0},
+	57:   {region: 0x6a, script: 0x5, flags: 0x0},
+	58:   {region: 0x0, script: 0x3, flags: 0x1},
+	59:   {region: 0x164, script: 0x52, flags: 0x0},
+	60:   {region: 0x50, script: 0x52, flags: 0x0},
+	61:   {region: 0x3e, script: 0x52, flags: 0x0},
+	62:   {region: 0x66, script: 0x5, flags: 0x0},
+	64:   {region: 0xb9, script: 0x5, flags: 0x0},
+	65:   {region: 0x6a, script: 0x5, flags: 0x0},
+	66:   {region: 0x98, script: 0xe, flags: 0x0},
+	67:   {region: 0x12e, script: 0x52, flags: 0x0},
+	68:   {region: 0x134, script: 0xbc, flags: 0x0},
+	69:   {region: 0x164, script: 0x52, flags: 0x0},
+	70:   {region: 0x164, script: 0x52, flags: 0x0},
+	71:   {region: 0x6d, script: 0x52, flags: 0x0},
+	72:   {region: 0x164, script: 0x52, flags: 0x0},
+	73:   {region: 0x164, script: 0x52, flags: 0x0},
+	74:   {region: 0x48, script: 0x52, flags: 0x0},
+	75:   {region: 0x164, script: 0x52, flags: 0x0},
+	76:   {region: 0x105, script: 0x1e, flags: 0x0},
+	77:   {region: 0x164, script: 0x5, flags: 0x0},
+	78:   {region: 0x164, script: 0x52, flags: 0x0},
+	79:   {region: 0x164, script: 0x52, flags: 0x0},
+	80:   {region: 0x164, script: 0x52, flags: 0x0},
+	81:   {region: 0x98, script: 0x20, flags: 0x0},
+	82:   {region: 0x164, script: 0x52, flags: 0x0},
+	83:   {region: 0x164, script: 0x52, flags: 0x0},
+	84:   {region: 0x164, script: 0x52, flags: 0x0},
+	85:   {region: 0x3e, script: 0x52, flags: 0x0},
+	86:   {region: 0x164, script: 0x52, flags: 0x0},
+	87:   {region: 0x3, script: 0x5, flags: 0x1},
+	88:   {region: 0x105, script: 0x1e, flags: 0x0},
+	89:   {region: 0xe7, script: 0x5, flags: 0x0},
+	90:   {region: 0x94, script: 0x52, flags: 0x0},
+	91:   {region: 0xda, script: 0x20, flags: 0x0},
+	92:   {region: 0x2d, script: 0x52, flags: 0x0},
+	93:   {region: 0x51, script: 0x52, flags: 0x0},
+	94:   {region: 0x164, script: 0x52, flags: 0x0},
+	95:   {region: 0x51, script: 0xb, flags: 0x0},
+	96:   {region: 0x164, script: 0x52, flags: 0x0},
+	97:   {region: 0x164, script: 0x52, flags: 0x0},
+	98:   {region: 0x94, script: 0x52, flags: 0x0},
+	99:   {region: 0x164, script: 0x52, flags: 0x0},
+	100:  {region: 0x51, script: 0x52, flags: 0x0},
+	101:  {region: 0x164, script: 0x52, flags: 0x0},
+	102:  {region: 0x164, script: 0x52, flags: 0x0},
+	103:  {region: 0x164, script: 0x52, flags: 0x0},
+	104:  {region: 0x164, script: 0x52, flags: 0x0},
+	105:  {region: 0x4e, script: 0x52, flags: 0x0},
+	106:  {region: 0x164, script: 0x52, flags: 0x0},
+	107:  {region: 0x164, script: 0x52, flags: 0x0},
+	108:  {region: 0x164, script: 0x52, flags: 0x0},
+	109:  {region: 0x164, script: 0x27, flags: 0x0},
+	110:  {region: 0x164, script: 0x52, flags: 0x0},
+	111:  {region: 0x164, script: 0x52, flags: 0x0},
+	112:  {region: 0x46, script: 0x1e, flags: 0x0},
+	113:  {region: 0x164, script: 0x52, flags: 0x0},
+	114:  {region: 0x164, script: 0x52, flags: 0x0},
+	115:  {region: 0x10a, script: 0x5, flags: 0x0},
+	116:  {region: 0x161, script: 0x52, flags: 0x0},
+	117:  {region: 0x164, script: 0x52, flags: 0x0},
+	118:  {region: 0x94, script: 0x52, flags: 0x0},
+	119:  {region: 0x164, script: 0x52, flags: 0x0},
+	120:  {region: 0x12e, script: 0x52, flags: 0x0},
+	121:  {region: 0x51, script: 0x52, flags: 0x0},
+	122:  {region: 0x98, script: 0xcd, flags: 0x0},
+	123:  {region: 0xe7, script: 0x5, flags: 0x0},
+	124:  {region: 0x98, script: 0x20, flags: 0x0},
+	125:  {region: 0x37, script: 0x1e, flags: 0x0},
+	126:  {region: 0x98, script: 0x20, flags: 0x0},
+	127:  {region: 0xe7, script: 0x5, flags: 0x0},
+	128:  {region: 0x12a, script: 0x2d, flags: 0x0},
+	130:  {region: 0x98, script: 0x20, flags: 0x0},
+	131:  {region: 0x164, script: 0x52, flags: 0x0},
+	132:  {region: 0x98, script: 0x20, flags: 0x0},
+	133:  {region: 0xe6, script: 0x52, flags: 0x0},
+	134:  {region: 0x164, script: 0x52, flags: 0x0},
+	135:  {region: 0x98, script: 0x20, flags: 0x0},
+	136:  {region: 0x164, script: 0x52, flags: 0x0},
+	137:  {region: 0x13e, script: 0x52, flags: 0x0},
+	138:  {region: 0x164, script: 0x52, flags: 0x0},
+	139:  {region: 0x164, script: 0x52, flags: 0x0},
+	140:  {region: 0xe6, script: 0x52, flags: 0x0},
+	141:  {region: 0x164, script: 0x52, flags: 0x0},
+	142:  {region: 0xd5, script: 0x52, flags: 0x0},
+	143:  {region: 0x164, script: 0x52, flags: 0x0},
+	144:  {region: 0x164, script: 0x52, flags: 0x0},
+	145:  {region: 0x164, script: 0x52, flags: 0x0},
+	146:  {region: 0x164, script: 0x27, flags: 0x0},
+	147:  {region: 0x98, script: 0x20, flags: 0x0},
+	148:  {region: 0x94, script: 0x52, flags: 0x0},
+	149:  {region: 0x164, script: 0x52, flags: 0x0},
+	150:  {region: 0x164, script: 0x52, flags: 0x0},
+	151:  {region: 0x164, script: 0x52, flags: 0x0},
+	152:  {region: 0x164, script: 0x52, flags: 0x0},
+	153:  {region: 0x51, script: 0x52, flags: 0x0},
+	154:  {region: 0x164, script: 0x52, flags: 0x0},
+	155:  {region: 0xe6, script: 0x52, flags: 0x0},
+	156:  {region: 0x164, script: 0x52, flags: 0x0},
+	157:  {region: 0x13d, script: 0xcf, flags: 0x0},
+	158:  {region: 0xc2, script: 0x52, flags: 0x0},
+	159:  {region: 0x164, script: 0x52, flags: 0x0},
+	160:  {region: 0x164, script: 0x52, flags: 0x0},
+	161:  {region: 0xc2, script: 0x52, flags: 0x0},
+	162:  {region: 0x164, script: 0x52, flags: 0x0},
+	163:  {region: 0x34, script: 0xe, flags: 0x0},
+	164:  {region: 0x164, script: 0x52, flags: 0x0},
+	165:  {region: 0x164, script: 0x52, flags: 0x0},
+	166:  {region: 0x164, script: 0x52, flags: 0x0},
+	167:  {region: 0x52, script: 0xd6, flags: 0x0},
+	168:  {region: 0x164, script: 0x52, flags: 0x0},
+	169:  {region: 0x164, script: 0x52, flags: 0x0},
+	170:  {region: 0x164, script: 0x52, flags: 0x0},
+	171:  {region: 0x98, script: 0xe, flags: 0x0},
+	172:  {region: 0x164, script: 0x52, flags: 0x0},
+	173:  {region: 0x9b, script: 0x5, flags: 0x0},
+	174:  {region: 0x164, script: 0x52, flags: 0x0},
+	175:  {region: 0x4e, script: 0x52, flags: 0x0},
+	176:  {region: 0x77, script: 0x52, flags: 0x0},
+	177:  {region: 0x98, script: 0x20, flags: 0x0},
+	178:  {region: 0xe7, script: 0x5, flags: 0x0},
+	179:  {region: 0x98, script: 0x20, flags: 0x0},
+	180:  {region: 0x164, script: 0x52, flags: 0x0},
+	181:  {region: 0x32, script: 0x52, flags: 0x0},
+	182:  {region: 0x164, script: 0x52, flags: 0x0},
+	183:  {region: 0xb3, script: 0xc, flags: 0x0},
+	184:  {region: 0x51, script: 0x52, flags: 0x0},
+	185:  {region: 0x164, script: 0x27, flags: 0x0},
+	186:  {region: 0xe6, script: 0x52, flags: 0x0},
+	187:  {region: 0x164, script: 0x52, flags: 0x0},
+	188:  {region: 0xe7, script: 0x20, flags: 0x0},
+	189:  {region: 0x105, script: 0x1e, flags: 0x0},
+	190:  {region: 0x15e, script: 0x52, flags: 0x0},
+	191:  {region: 0x164, script: 0x52, flags: 0x0},
+	192:  {region: 0x94, script: 0x52, flags: 0x0},
+	193:  {region: 0x164, script: 0x52, flags: 0x0},
+	194:  {region: 0x51, script: 0x52, flags: 0x0},
+	195:  {region: 0x164, script: 0x52, flags: 0x0},
+	196:  {region: 0x164, script: 0x52, flags: 0x0},
+	197:  {region: 0x164, script: 0x52, flags: 0x0},
+	198:  {region: 0x85, script: 0x52, flags: 0x0},
+	199:  {region: 0x164, script: 0x52, flags: 0x0},
+	200:  {region: 0x164, script: 0x52, flags: 0x0},
+	201:  {region: 0x164, script: 0x52, flags: 0x0},
+	202:  {region: 0x164, script: 0x52, flags: 0x0},
+	203:  {region: 0x6c, script: 0x27, flags: 0x0},
+	204:  {region: 0x164, script: 0x52, flags: 0x0},
+	205:  {region: 0x164, script: 0x52, flags: 0x0},
+	206:  {region: 0x51, script: 0x52, flags: 0x0},
+	207:  {region: 0x164, script: 0x52, flags: 0x0},
+	208:  {region: 0x164, script: 0x52, flags: 0x0},
+	209:  {region: 0xc2, script: 0x52, flags: 0x0},
+	210:  {region: 0x164, script: 0x52, flags: 0x0},
+	211:  {region: 0x164, script: 0x52, flags: 0x0},
+	212:  {region: 0x164, script: 0x52, flags: 0x0},
+	213:  {region: 0x6d, script: 0x52, flags: 0x0},
+	214:  {region: 0x164, script: 0x52, flags: 0x0},
+	215:  {region: 0x164, script: 0x52, flags: 0x0},
+	216:  {region: 0xd5, script: 0x52, flags: 0x0},
+	217:  {region: 0x8, script: 0x2, flags: 0x1},
+	218:  {region: 0x105, script: 0x1e, flags: 0x0},
+	219:  {region: 0xe6, script: 0x52, flags: 0x0},
+	220:  {region: 0x164, script: 0x52, flags: 0x0},
+	221:  {region: 0x130, script: 0x52, flags: 0x0},
+	222:  {region: 0x89, script: 0x52, flags: 0x0},
+	223:  {region: 0x74, script: 0x52, flags: 0x0},
+	224:  {region: 0x105, script: 0x1e, flags: 0x0},
+	225:  {region: 0x134, script: 0x52, flags: 0x0},
+	226:  {region: 0x48, script: 0x52, flags: 0x0},
+	227:  {region: 0x134, script: 0x1a, flags: 0x0},
+	228:  {region: 0xa5, script: 0x5, flags: 0x0},
+	229:  {region: 0x13d, script: 0x19, flags: 0x0},
+	230:  {region: 0x164, script: 0x52, flags: 0x0},
+	231:  {region: 0x9a, script: 0x5, flags: 0x0},
+	232:  {region: 0x164, script: 0x52, flags: 0x0},
+	233:  {region: 0x164, script: 0x52, flags: 0x0},
+	234:  {region: 0x164, script: 0x52, flags: 0x0},
+	235:  {region: 0x164, script: 0x52, flags: 0x0},
+	236:  {region: 0x164, script: 0x52, flags: 0x0},
+	237:  {region: 0x77, script: 0x52, flags: 0x0},
+	238:  {region: 0x6a, script: 0x1c, flags: 0x0},
+	239:  {region: 0xe6, script: 0x52, flags: 0x0},
+	240:  {region: 0x48, script: 0x17, flags: 0x0},
+	241:  {region: 0x48, script: 0x17, flags: 0x0},
+	242:  {region: 0x48, script: 0x17, flags: 0x0},
+	243:  {region: 0x48, script: 0x17, flags: 0x0},
+	244:  {region: 0x48, script: 0x17, flags: 0x0},
+	245:  {region: 0x109, script: 0x52, flags: 0x0},
+	246:  {region: 0x5d, script: 0x52, flags: 0x0},
+	247:  {region: 0xe8, script: 0x52, flags: 0x0},
+	248:  {region: 0x48, script: 0x17, flags: 0x0},
+	249:  {region: 0xc3, script: 0x79, flags: 0x0},
+	250:  {region: 0xa, script: 0x2, flags: 0x1},
+	251:  {region: 0x105, script: 0x1e, flags: 0x0},
+	252:  {region: 0x7a, script: 0x52, flags: 0x0},
+	253:  {region: 0x62, script: 0x52, flags: 0x0},
+	254:  {region: 0x164, script: 0x52, flags: 0x0},
+	255:  {region: 0x164, script: 0x52, flags: 0x0},
+	256:  {region: 0x164, script: 0x52, flags: 0x0},
+	257:  {region: 0x164, script: 0x52, flags: 0x0},
+	258:  {region: 0x134, script: 0x52, flags: 0x0},
+	259:  {region: 0x105, script: 0x1e, flags: 0x0},
+	260:  {region: 0xa3, script: 0x52, flags: 0x0},
+	261:  {region: 0x164, script: 0x52, flags: 0x0},
+	262:  {region: 0x164, script: 0x52, flags: 0x0},
+	263:  {region: 0x98, script: 0x5, flags: 0x0},
+	264:  {region: 0x164, script: 0x52, flags: 0x0},
+	265:  {region: 0x5f, script: 0x52, flags: 0x0},
+	266:  {region: 0x164, script: 0x52, flags: 0x0},
+	267:  {region: 0x48, script: 0x52, flags: 0x0},
+	268:  {region: 0x164, script: 0x52, flags: 0x0},
+	269:  {region: 0x164, script: 0x52, flags: 0x0},
+	270:  {region: 0x164, script: 0x52, flags: 0x0},
+	271:  {region: 0x164, script: 0x5, flags: 0x0},
+	272:  {region: 0x48, script: 0x52, flags: 0x0},
+	273:  {region: 0x164, script: 0x52, flags: 0x0},
+	274:  {region: 0x164, script: 0x52, flags: 0x0},
+	275:  {region: 0xd3, script: 0x52, flags: 0x0},
+	276:  {region: 0x4e, script: 0x52, flags: 0x0},
+	277:  {region: 0x164, script: 0x52, flags: 0x0},
+	278:  {region: 0x98, script: 0x5, flags: 0x0},
+	279:  {region: 0x164, script: 0x52, flags: 0x0},
+	280:  {region: 0x164, script: 0x52, flags: 0x0},
+	281:  {region: 0x164, script: 0x52, flags: 0x0},
+	282:  {region: 0x164, script: 0x27, flags: 0x0},
+	283:  {region: 0x5f, script: 0x52, flags: 0x0},
+	284:  {region: 0xc2, script: 0x52, flags: 0x0},
+	285:  {region: 0xcf, script: 0x52, flags: 0x0},
+	286:  {region: 0x164, script: 0x52, flags: 0x0},
+	287:  {region: 0xda, script: 0x20, flags: 0x0},
+	288:  {region: 0x51, script: 0x52, flags: 0x0},
+	289:  {region: 0x164, script: 0x52, flags: 0x0},
+	290:  {region: 0x164, script: 0x52, flags: 0x0},
+	291:  {region: 0x164, script: 0x52, flags: 0x0},
+	292:  {region: 0xcc, script: 0xd4, flags: 0x0},
+	293:  {region: 0x164, script: 0x52, flags: 0x0},
+	294:  {region: 0x164, script: 0x52, flags: 0x0},
+	295:  {region: 0x113, script: 0x52, flags: 0x0},
+	296:  {region: 0x36, script: 0x52, flags: 0x0},
+	297:  {region: 0x42, script: 0xd6, flags: 0x0},
+	298:  {region: 0x164, script: 0x52, flags: 0x0},
+	299:  {region: 0xa3, script: 0x52, flags: 0x0},
+	300:  {region: 0x7f, script: 0x52, flags: 0x0},
+	301:  {region: 0xd5, script: 0x52, flags: 0x0},
+	302:  {region: 0x9d, script: 0x52, flags: 0x0},
+	303:  {region: 0x6a, script: 0x25, flags: 0x0},
+	304:  {region: 0xc3, script: 0x43, flags: 0x0},
+	305:  {region: 0x86, script: 0x2d, flags: 0x0},
+	306:  {region: 0x164, script: 0x52, flags: 0x0},
+	307:  {region: 0x164, script: 0x52, flags: 0x0},
+	308:  {region: 0xc, script: 0x2, flags: 0x1},
+	309:  {region: 0x164, script: 0x52, flags: 0x0},
+	310:  {region: 0x164, script: 0x52, flags: 0x0},
+	311:  {region: 0x1, script: 0x52, flags: 0x0},
+	312:  {region: 0x164, script: 0x52, flags: 0x0},
+	313:  {region: 0x6d, script: 0x52, flags: 0x0},
+	314:  {region: 0x134, script: 0x52, flags: 0x0},
+	315:  {region: 0x69, script: 0x52, flags: 0x0},
+	316:  {region: 0x164, script: 0x52, flags: 0x0},
+	317:  {region: 0x9d, script: 0x3e, flags: 0x0},
+	318:  {region: 0x164, script: 0x52, flags: 0x0},
+	319:  {region: 0x164, script: 0x52, flags: 0x0},
+	320:  {region: 0x6d, script: 0x52, flags: 0x0},
+	321:  {region: 0x51, script: 0x52, flags: 0x0},
+	322:  {region: 0x6d, script: 0x52, flags: 0x0},
+	323:  {region: 0x9b, script: 0x5, flags: 0x0},
+	324:  {region: 0x164, script: 0x52, flags: 0x0},
+	325:  {region: 0x164, script: 0x52, flags: 0x0},
+	326:  {region: 0x164, script: 0x52, flags: 0x0},
+	327:  {region: 0x164, script: 0x52, flags: 0x0},
+	328:  {region: 0x85, script: 0x52, flags: 0x0},
+	329:  {region: 0xe, script: 0x2, flags: 0x1},
+	330:  {region: 0x164, script: 0x52, flags: 0x0},
+	331:  {region: 0xc2, script: 0x52, flags: 0x0},
+	332:  {region: 0x71, script: 0x52, flags: 0x0},
+	333:  {region: 0x10a, script: 0x5, flags: 0x0},
+	334:  {region: 0xe6, script: 0x52, flags: 0x0},
+	335:  {region: 0x10b, script: 0x52, flags: 0x0},
+	336:  {region: 0x72, script: 0x52, flags: 0x0},
+	337:  {region: 0x164, script: 0x52, flags: 0x0},
+	338:  {region: 0x164, script: 0x52, flags: 0x0},
+	339:  {region: 0x75, script: 0x52, flags: 0x0},
+	340:  {region: 0x164, script: 0x52, flags: 0x0},
+	341:  {region: 0x3a, script: 0x52, flags: 0x0},
+	342:  {region: 0x164, script: 0x52, flags: 0x0},
+	343:  {region: 0x164, script: 0x52, flags: 0x0},
+	344:  {region: 0x164, script: 0x52, flags: 0x0},
+	345:  {region: 0x77, script: 0x52, flags: 0x0},
+	346:  {region: 0x134, script: 0x52, flags: 0x0},
+	347:  {region: 0x77, script: 0x52, flags: 0x0},
+	348:  {region: 0x5f, script: 0x52, flags: 0x0},
+	349:  {region: 0x5f, script: 0x52, flags: 0x0},
+	350:  {region: 0x51, script: 0x5, flags: 0x0},
+	351:  {region: 0x13f, script: 0x52, flags: 0x0},
+	352:  {region: 0x164, script: 0x52, flags: 0x0},
+	353:  {region: 0x83, script: 0x52, flags: 0x0},
+	354:  {region: 0x164, script: 0x52, flags: 0x0},
+	355:  {region: 0xd3, script: 0x52, flags: 0x0},
+	356:  {region: 0x9d, script: 0x52, flags: 0x0},
+	357:  {region: 0xd5, script: 0x52, flags: 0x0},
+	358:  {region: 0x164, script: 0x52, flags: 0x0},
+	359:  {region: 0x10a, script: 0x52, flags: 0x0},
+	360:  {region: 0xd8, script: 0x52, flags: 0x0},
+	361:  {region: 0x95, script: 0x52, flags: 0x0},
+	362:  {region: 0x7f, script: 0x52, flags: 0x0},
+	363:  {region: 0x164, script: 0x52, flags: 0x0},
+	364:  {region: 0xbb, script: 0x52, flags: 0x0},
+	365:  {region: 0x164, script: 0x52, flags: 0x0},
+	366:  {region: 0x164, script: 0x52, flags: 0x0},
+	367:  {region: 0x164, script: 0x52, flags: 0x0},
+	368:  {region: 0x52, script: 0x34, flags: 0x0},
+	369:  {region: 0x164, script: 0x52, flags: 0x0},
+	370:  {region: 0x94, script: 0x52, flags: 0x0},
+	371:  {region: 0x164, script: 0x52, flags: 0x0},
+	372:  {region: 0x98, script: 0x20, flags: 0x0},
+	373:  {region: 0x164, script: 0x52, flags: 0x0},
+	374:  {region: 0x9b, script: 0x5, flags: 0x0},
+	375:  {region: 0x7d, script: 0x52, flags: 0x0},
+	376:  {region: 0x7a, script: 0x52, flags: 0x0},
+	377:  {region: 0x164, script: 0x52, flags: 0x0},
+	378:  {region: 0x164, script: 0x52, flags: 0x0},
+	379:  {region: 0x164, script: 0x52, flags: 0x0},
+	380:  {region: 0x164, script: 0x52, flags: 0x0},
+	381:  {region: 0x164, script: 0x52, flags: 0x0},
+	382:  {region: 0x164, script: 0x52, flags: 0x0},
+	383:  {region: 0x6e, script: 0x27, flags: 0x0},
+	384:  {region: 0x164, script: 0x52, flags: 0x0},
+	385:  {region: 0xda, script: 0x20, flags: 0x0},
+	386:  {region: 0x164, script: 0x52, flags: 0x0},
+	387:  {region: 0xa6, script: 0x52, flags: 0x0},
+	388:  {region: 0x164, script: 0x52, flags: 0x0},
+	389:  {region: 0xe7, script: 0x5, flags: 0x0},
+	390:  {region: 0x164, script: 0x52, flags: 0x0},
+	391:  {region: 0xe7, script: 0x5, flags: 0x0},
+	392:  {region: 0x164, script: 0x52, flags: 0x0},
+	393:  {region: 0x164, script: 0x52, flags: 0x0},
+	394:  {region: 0x6d, script: 0x52, flags: 0x0},
+	395:  {region: 0x9b, script: 0x5, flags: 0x0},
+	396:  {region: 0x164, script: 0x52, flags: 0x0},
+	397:  {region: 0x164, script: 0x27, flags: 0x0},
+	398:  {region: 0xf0, script: 0x52, flags: 0x0},
+	399:  {region: 0x164, script: 0x52, flags: 0x0},
+	400:  {region: 0x164, script: 0x52, flags: 0x0},
+	401:  {region: 0x164, script: 0x52, flags: 0x0},
+	402:  {region: 0x164, script: 0x27, flags: 0x0},
+	403:  {region: 0x164, script: 0x52, flags: 0x0},
+	404:  {region: 0x98, script: 0x20, flags: 0x0},
+	405:  {region: 0x98, script: 0xd0, flags: 0x0},
+	406:  {region: 0x94, script: 0x52, flags: 0x0},
+	407:  {region: 0xd8, script: 0x52, flags: 0x0},
+	408:  {region: 0x12f, script: 0x2b, flags: 0x0},
+	409:  {region: 0x10, script: 0x2, flags: 0x1},
+	410:  {region: 0x98, script: 0xe, flags: 0x0},
+	411:  {region: 0x164, script: 0x52, flags: 0x0},
+	412:  {region: 0x4d, script: 0x52, flags: 0x0},
+	413:  {region: 0x98, script: 0x2e, flags: 0x0},
+	414:  {region: 0x40, script: 0x52, flags: 0x0},
+	415:  {region: 0x53, script: 0x52, flags: 0x0},
+	416:  {region: 0x164, script: 0x52, flags: 0x0},
+	417:  {region: 0x7f, script: 0x52, flags: 0x0},
+	418:  {region: 0x164, script: 0x52, flags: 0x0},
+	419:  {region: 0x164, script: 0x52, flags: 0x0},
+	420:  {region: 0xa3, script: 0x52, flags: 0x0},
+	421:  {region: 0x97, script: 0x52, flags: 0x0},
+	422:  {region: 0x164, script: 0x52, flags: 0x0},
+	423:  {region: 0xda, script: 0x20, flags: 0x0},
+	424:  {region: 0x164, script: 0x52, flags: 0x0},
+	425:  {region: 0x164, script: 0x5, flags: 0x0},
+	426:  {region: 0x48, script: 0x52, flags: 0x0},
+	427:  {region: 0x164, script: 0x5, flags: 0x0},
+	428:  {region: 0x164, script: 0x52, flags: 0x0},
+	429:  {region: 0x12, script: 0x3, flags: 0x1},
+	430:  {region: 0x164, script: 0x52, flags: 0x0},
+	431:  {region: 0x52, script: 0x34, flags: 0x0},
+	432:  {region: 0x164, script: 0x52, flags: 0x0},
+	433:  {region: 0x134, script: 0x52, flags: 0x0},
+	434:  {region: 0x23, script: 0x5, flags: 0x0},
+	435:  {region: 0x164, script: 0x52, flags: 0x0},
+	436:  {region: 0x164, script: 0x27, flags: 0x0},
+	437:  {region: 0x96, script: 0x37, flags: 0x0},
+	438:  {region: 0x164, script: 0x52, flags: 0x0},
+	439:  {region: 0x98, script: 0x20, flags: 0x0},
+	440:  {region: 0x164, script: 0x52, flags: 0x0},
+	441:  {region: 0x72, script: 0x52, flags: 0x0},
+	442:  {region: 0x164, script: 0x52, flags: 0x0},
+	443:  {region: 0x164, script: 0x52, flags: 0x0},
+	444:  {region: 0xe6, script: 0x52, flags: 0x0},
+	445:  {region: 0x164, script: 0x52, flags: 0x0},
+	446:  {region: 0x12a, script: 0x39, flags: 0x0},
+	447:  {region: 0x52, script: 0x81, flags: 0x0},
+	448:  {region: 0x164, script: 0x52, flags: 0x0},
+	449:  {region: 0xe7, script: 0x5, flags: 0x0},
+	450:  {region: 0x98, script: 0x20, flags: 0x0},
+	451:  {region: 0xae, script: 0x3a, flags: 0x0},
+	452:  {region: 0xe6, script: 0x52, flags: 0x0},
+	453:  {region: 0xe7, script: 0x5, flags: 0x0},
+	454:  {region: 0xe5, script: 0x52, flags: 0x0},
+	455:  {region: 0x98, script: 0x20, flags: 0x0},
+	456:  {region: 0x98, script: 0x20, flags: 0x0},
+	457:  {region: 0x164, script: 0x52, flags: 0x0},
+	458:  {region: 0x8f, script: 0x52, flags: 0x0},
+	459:  {region: 0x5f, script: 0x52, flags: 0x0},
+	460:  {region: 0x52, script: 0x34, flags: 0x0},
+	461:  {region: 0x90, script: 0x52, flags: 0x0},
+	462:  {region: 0x91, script: 0x52, flags: 0x0},
+	463:  {region: 0x164, script: 0x52, flags: 0x0},
+	464:  {region: 0x27, script: 0x8, flags: 0x0},
+	465:  {region: 0xd1, script: 0x52, flags: 0x0},
+	466:  {region: 0x77, script: 0x52, flags: 0x0},
+	467:  {region: 0x164, script: 0x52, flags: 0x0},
+	468:  {region: 0x164, script: 0x52, flags: 0x0},
+	469:  {region: 0xcf, script: 0x52, flags: 0x0},
+	470:  {region: 0xd5, script: 0x52, flags: 0x0},
+	471:  {region: 0x164, script: 0x52, flags: 0x0},
+	472:  {region: 0x164, script: 0x52, flags: 0x0},
+	473:  {region: 0x164, script: 0x52, flags: 0x0},
+	474:  {region: 0x94, script: 0x52, flags: 0x0},
+	475:  {region: 0x164, script: 0x52, flags: 0x0},
+	476:  {region: 0x164, script: 0x52, flags: 0x0},
+	477:  {region: 0x164, script: 0x52, flags: 0x0},
+	479:  {region: 0xd5, script: 0x52, flags: 0x0},
+	480:  {region: 0x164, script: 0x52, flags: 0x0},
+	481:  {region: 0x164, script: 0x52, flags: 0x0},
+	482:  {region: 0x52, script: 0xdf, flags: 0x0},
+	483:  {region: 0x164, script: 0x52, flags: 0x0},
+	484:  {region: 0x134, script: 0x52, flags: 0x0},
+	485:  {region: 0x164, script: 0x52, flags: 0x0},
+	486:  {region: 0x48, script: 0x52, flags: 0x0},
+	487:  {region: 0x164, script: 0x52, flags: 0x0},
+	488:  {region: 0x164, script: 0x52, flags: 0x0},
+	489:  {region: 0xe6, script: 0x52, flags: 0x0},
+	490:  {region: 0x164, script: 0x52, flags: 0x0},
+	491:  {region: 0x94, script: 0x52, flags: 0x0},
+	492:  {region: 0x105, script: 0x1e, flags: 0x0},
+	494:  {region: 0x164, script: 0x52, flags: 0x0},
+	495:  {region: 0x164, script: 0x52, flags: 0x0},
+	496:  {region: 0x9c, script: 0x52, flags: 0x0},
+	497:  {region: 0x9d, script: 0x52, flags: 0x0},
+	498:  {region: 0x48, script: 0x17, flags: 0x0},
+	499:  {region: 0x96, script: 0x37, flags: 0x0},
+	500:  {region: 0x164, script: 0x52, flags: 0x0},
+	501:  {region: 0x164, script: 0x52, flags: 0x0},
+	502:  {region: 0x105, script: 0x52, flags: 0x0},
+	503:  {region: 0x164, script: 0x52, flags: 0x0},
+	504:  {region: 0xa1, script: 0x41, flags: 0x0},
+	505:  {region: 0x164, script: 0x52, flags: 0x0},
+	506:  {region: 0x9f, script: 0x52, flags: 0x0},
+	508:  {region: 0x164, script: 0x52, flags: 0x0},
+	509:  {region: 0x164, script: 0x52, flags: 0x0},
+	510:  {region: 0x164, script: 0x52, flags: 0x0},
+	511:  {region: 0x51, script: 0x52, flags: 0x0},
+	512:  {region: 0x12f, script: 0x37, flags: 0x0},
+	513:  {region: 0x164, script: 0x52, flags: 0x0},
+	514:  {region: 0x12e, script: 0x52, flags: 0x0},
+	515:  {region: 0xda, script: 0x20, flags: 0x0},
+	516:  {region: 0x164, script: 0x52, flags: 0x0},
+	517:  {region: 0x62, script: 0x52, flags: 0x0},
+	518:  {region: 0x94, script: 0x52, flags: 0x0},
+	519:  {region: 0x94, script: 0x52, flags: 0x0},
+	520:  {region: 0x7c, script: 0x29, flags: 0x0},
+	521:  {region: 0x136, script: 0x1e, flags: 0x0},
+	522:  {region: 0x66, script: 0x52, flags: 0x0},
+	523:  {region: 0xc3, script: 0x52, flags: 0x0},
+	524:  {region: 0x164, script: 0x52, flags: 0x0},
+	525:  {region: 0x164, script: 0x52, flags: 0x0},
+	526:  {region: 0xd5, script: 0x52, flags: 0x0},
+	527:  {region: 0xa3, script: 0x52, flags: 0x0},
+	528:  {region: 0xc2, script: 0x52, flags: 0x0},
+	529:  {region: 0x105, script: 0x1e, flags: 0x0},
+	530:  {region: 0x164, script: 0x52, flags: 0x0},
+	531:  {region: 0x164, script: 0x52, flags: 0x0},
+	532:  {region: 0x164, script: 0x52, flags: 0x0},
+	533:  {region: 0x164, script: 0x52, flags: 0x0},
+	534:  {region: 0xd3, script: 0x5, flags: 0x0},
+	535:  {region: 0xd5, script: 0x52, flags: 0x0},
+	536:  {region: 0x163, script: 0x52, flags: 0x0},
+	537:  {region: 0x164, script: 0x52, flags: 0x0},
+	538:  {region: 0x164, script: 0x52, flags: 0x0},
+	539:  {region: 0x12e, script: 0x52, flags: 0x0},
+	540:  {region: 0x121, script: 0x5, flags: 0x0},
+	541:  {region: 0x164, script: 0x52, flags: 0x0},
+	542:  {region: 0x122, script: 0xd5, flags: 0x0},
+	543:  {region: 0x59, script: 0x52, flags: 0x0},
+	544:  {region: 0x51, script: 0x52, flags: 0x0},
+	545:  {region: 0x164, script: 0x52, flags: 0x0},
+	546:  {region: 0x4e, script: 0x52, flags: 0x0},
+	547:  {region: 0x98, script: 0x20, flags: 0x0},
+	548:  {region: 0x98, script: 0x20, flags: 0x0},
+	549:  {region: 0x4a, script: 0x52, flags: 0x0},
+	550:  {region: 0x94, script: 0x52, flags: 0x0},
+	551:  {region: 0x164, script: 0x52, flags: 0x0},
+	552:  {region: 0x40, script: 0x52, flags: 0x0},
+	553:  {region: 0x98, script: 0x52, flags: 0x0},
+	554:  {region: 0x52, script: 0xcc, flags: 0x0},
+	555:  {region: 0x98, script: 0x20, flags: 0x0},
+	556:  {region: 0xc2, script: 0x52, flags: 0x0},
+	557:  {region: 0x164, script: 0x52, flags: 0x0},
+	558:  {region: 0x98, script: 0x6b, flags: 0x0},
+	559:  {region: 0xe7, script: 0x5, flags: 0x0},
+	560:  {region: 0x164, script: 0x52, flags: 0x0},
+	561:  {region: 0xa3, script: 0x52, flags: 0x0},
+	562:  {region: 0x164, script: 0x52, flags: 0x0},
+	563:  {region: 0x12a, script: 0x52, flags: 0x0},
+	564:  {region: 0x164, script: 0x52, flags: 0x0},
+	565:  {region: 0xd1, script: 0x52, flags: 0x0},
+	566:  {region: 0x164, script: 0x52, flags: 0x0},
+	567:  {region: 0xae, script: 0x4f, flags: 0x0},
+	568:  {region: 0x164, script: 0x52, flags: 0x0},
+	569:  {region: 0x164, script: 0x52, flags: 0x0},
+	570:  {region: 0x15, script: 0x6, flags: 0x1},
+	571:  {region: 0x164, script: 0x52, flags: 0x0},
+	572:  {region: 0x51, script: 0x52, flags: 0x0},
+	573:  {region: 0x81, script: 0x52, flags: 0x0},
+	574:  {region: 0xa3, script: 0x52, flags: 0x0},
+	575:  {region: 0x164, script: 0x52, flags: 0x0},
+	576:  {region: 0x164, script: 0x52, flags: 0x0},
+	577:  {region: 0x164, script: 0x52, flags: 0x0},
+	578:  {region: 0xa5, script: 0x46, flags: 0x0},
+	579:  {region: 0x29, script: 0x52, flags: 0x0},
+	580:  {region: 0x164, script: 0x52, flags: 0x0},
+	581:  {region: 0x164, script: 0x52, flags: 0x0},
+	582:  {region: 0x164, script: 0x52, flags: 0x0},
+	583:  {region: 0x164, script: 0x52, flags: 0x0},
+	584:  {region: 0x164, script: 0x52, flags: 0x0},
+	585:  {region: 0x98, script: 0x4a, flags: 0x0},
+	586:  {region: 0x164, script: 0x52, flags: 0x0},
+	587:  {region: 0xaa, script: 0x4b, flags: 0x0},
+	588:  {region: 0x105, script: 0x1e, flags: 0x0},
+	589:  {region: 0x98, script: 0x20, flags: 0x0},
+	590:  {region: 0x164, script: 0x52, flags: 0x0},
+	591:  {region: 0x74, script: 0x52, flags: 0x0},
+	592:  {region: 0x164, script: 0x52, flags: 0x0},
+	593:  {region: 0xb3, script: 0x52, flags: 0x0},
+	594:  {region: 0x164, script: 0x52, flags: 0x0},
+	595:  {region: 0x164, script: 0x52, flags: 0x0},
+	596:  {region: 0x164, script: 0x52, flags: 0x0},
+	597:  {region: 0x164, script: 0x52, flags: 0x0},
+	598:  {region: 0x164, script: 0x52, flags: 0x0},
+	599:  {region: 0x164, script: 0x52, flags: 0x0},
+	600:  {region: 0x164, script: 0x52, flags: 0x0},
+	601:  {region: 0x164, script: 0x27, flags: 0x0},
+	603:  {region: 0x105, script: 0x1e, flags: 0x0},
+	604:  {region: 0x111, script: 0x52, flags: 0x0},
+	605:  {region: 0xe6, script: 0x52, flags: 0x0},
+	606:  {region: 0x105, script: 0x52, flags: 0x0},
+	607:  {region: 0x164, script: 0x52, flags: 0x0},
+	608:  {region: 0x98, script: 0x20, flags: 0x0},
+	609:  {region: 0x98, script: 0x5, flags: 0x0},
+	610:  {region: 0x12e, script: 0x52, flags: 0x0},
+	611:  {region: 0x164, script: 0x52, flags: 0x0},
+	612:  {region: 0x51, script: 0x52, flags: 0x0},
+	613:  {region: 0x5f, script: 0x52, flags: 0x0},
+	614:  {region: 0x164, script: 0x52, flags: 0x0},
+	615:  {region: 0x164, script: 0x52, flags: 0x0},
+	616:  {region: 0x164, script: 0x27, flags: 0x0},
+	617:  {region: 0x164, script: 0x52, flags: 0x0},
+	618:  {region: 0x164, script: 0x52, flags: 0x0},
+	619:  {region: 0x1b, script: 0x3, flags: 0x1},
+	620:  {region: 0x164, script: 0x52, flags: 0x0},
+	621:  {region: 0x164, script: 0x52, flags: 0x0},
+	622:  {region: 0x164, script: 0x52, flags: 0x0},
+	623:  {region: 0x164, script: 0x52, flags: 0x0},
+	624:  {region: 0x105, script: 0x1e, flags: 0x0},
+	625:  {region: 0x164, script: 0x52, flags: 0x0},
+	626:  {region: 0x164, script: 0x52, flags: 0x0},
+	627:  {region: 0x164, script: 0x52, flags: 0x0},
+	628:  {region: 0x105, script: 0x1e, flags: 0x0},
+	629:  {region: 0x164, script: 0x52, flags: 0x0},
+	630:  {region: 0x94, script: 0x52, flags: 0x0},
+	631:  {region: 0xe7, script: 0x5, flags: 0x0},
+	632:  {region: 0x7a, script: 0x52, flags: 0x0},
+	633:  {region: 0x164, script: 0x52, flags: 0x0},
+	634:  {region: 0x164, script: 0x52, flags: 0x0},
+	635:  {region: 0x164, script: 0x52, flags: 0x0},
+	636:  {region: 0x164, script: 0x27, flags: 0x0},
+	637:  {region: 0x122, script: 0xd5, flags: 0x0},
+	638:  {region: 0xe7, script: 0x5, flags: 0x0},
+	639:  {region: 0x164, script: 0x52, flags: 0x0},
+	640:  {region: 0x164, script: 0x52, flags: 0x0},
+	641:  {region: 0x1e, script: 0x5, flags: 0x1},
+	642:  {region: 0x164, script: 0x52, flags: 0x0},
+	643:  {region: 0x164, script: 0x52, flags: 0x0},
+	644:  {region: 0x164, script: 0x52, flags: 0x0},
+	645:  {region: 0x137, script: 0x52, flags: 0x0},
+	646:  {region: 0x86, script: 0x56, flags: 0x0},
+	647:  {region: 0x96, script: 0x37, flags: 0x0},
+	648:  {region: 0x12e, script: 0x52, flags: 0x0},
+	649:  {region: 0xe7, script: 0x5, flags: 0x0},
+	650:  {region: 0x130, script: 0x52, flags: 0x0},
+	651:  {region: 0x164, script: 0x52, flags: 0x0},
+	652:  {region: 0xb6, script: 0x52, flags: 0x0},
+	653:  {region: 0x105, script: 0x1e, flags: 0x0},
+	654:  {region: 0x164, script: 0x52, flags: 0x0},
+	655:  {region: 0x94, script: 0x52, flags: 0x0},
+	656:  {region: 0x164, script: 0x52, flags: 0x0},
+	657:  {region: 0x52, script: 0xd5, flags: 0x0},
+	658:  {region: 0x164, script: 0x52, flags: 0x0},
+	659:  {region: 0x164, script: 0x52, flags: 0x0},
+	660:  {region: 0x164, script: 0x52, flags: 0x0},
+	661:  {region: 0x164, script: 0x52, flags: 0x0},
+	662:  {region: 0x98, script: 0x54, flags: 0x0},
+	663:  {region: 0x164, script: 0x52, flags: 0x0},
+	664:  {region: 0x164, script: 0x52, flags: 0x0},
+	665:  {region: 0x105, script: 0x1e, flags: 0x0},
+	666:  {region: 0x130, script: 0x52, flags: 0x0},
+	667:  {region: 0x164, script: 0x52, flags: 0x0},
+	668:  {region: 0xd8, script: 0x52, flags: 0x0},
+	669:  {region: 0x164, script: 0x52, flags: 0x0},
+	670:  {region: 0x164, script: 0x52, flags: 0x0},
+	671:  {region: 0x23, script: 0x2, flags: 0x1},
+	672:  {region: 0x164, script: 0x52, flags: 0x0},
+	673:  {region: 0x164, script: 0x52, flags: 0x0},
+	674:  {region: 0x9d, script: 0x52, flags: 0x0},
+	675:  {region: 0x52, script: 0x58, flags: 0x0},
+	676:  {region: 0x94, script: 0x52, flags: 0x0},
+	677:  {region: 0x9b, script: 0x5, flags: 0x0},
+	678:  {region: 0x134, script: 0x52, flags: 0x0},
+	679:  {region: 0x164, script: 0x52, flags: 0x0},
+	680:  {region: 0x164, script: 0x52, flags: 0x0},
+	681:  {region: 0x98, script: 0xd0, flags: 0x0},
+	682:  {region: 0x9d, script: 0x52, flags: 0x0},
+	683:  {region: 0x164, script: 0x52, flags: 0x0},
+	684:  {region: 0x4a, script: 0x52, flags: 0x0},
+	685:  {region: 0x164, script: 0x52, flags: 0x0},
+	686:  {region: 0x164, script: 0x52, flags: 0x0},
+	687:  {region: 0xae, script: 0x4f, flags: 0x0},
+	688:  {region: 0x164, script: 0x52, flags: 0x0},
+	689:  {region: 0x164, script: 0x52, flags: 0x0},
+	690:  {region: 0x4a, script: 0x52, flags: 0x0},
+	691:  {region: 0x164, script: 0x52, flags: 0x0},
+	692:  {region: 0x164, script: 0x52, flags: 0x0},
+	693:  {region: 0x161, script: 0x52, flags: 0x0},
+	694:  {region: 0x9b, script: 0x5, flags: 0x0},
+	695:  {region: 0xb5, script: 0x52, flags: 0x0},
+	696:  {region: 0xb7, script: 0x52, flags: 0x0},
+	697:  {region: 0x4a, script: 0x52, flags: 0x0},
+	698:  {region: 0x4a, script: 0x52, flags: 0x0},
+	699:  {region: 0xa3, script: 0x52, flags: 0x0},
+	700:  {region: 0xa3, script: 0x52, flags: 0x0},
+	701:  {region: 0x9b, script: 0x5, flags: 0x0},
+	702:  {region: 0xb7, script: 0x52, flags: 0x0},
+	703:  {region: 0x122, script: 0xd5, flags: 0x0},
+	704:  {region: 0x52, script: 0x34, flags: 0x0},
+	705:  {region: 0x12a, script: 0x52, flags: 0x0},
+	706:  {region: 0x94, script: 0x52, flags: 0x0},
+	707:  {region: 0x51, script: 0x52, flags: 0x0},
+	708:  {region: 0x98, script: 0x20, flags: 0x0},
+	709:  {region: 0x98, script: 0x20, flags: 0x0},
+	710:  {region: 0x94, script: 0x52, flags: 0x0},
+	711:  {region: 0x25, script: 0x3, flags: 0x1},
+	712:  {region: 0xa3, script: 0x52, flags: 0x0},
+	713:  {region: 0x164, script: 0x52, flags: 0x0},
+	714:  {region: 0xce, script: 0x52, flags: 0x0},
+	715:  {region: 0x164, script: 0x52, flags: 0x0},
+	716:  {region: 0x164, script: 0x52, flags: 0x0},
+	717:  {region: 0x164, script: 0x52, flags: 0x0},
+	718:  {region: 0x164, script: 0x52, flags: 0x0},
+	719:  {region: 0x164, script: 0x52, flags: 0x0},
+	720:  {region: 0x164, script: 0x52, flags: 0x0},
+	721:  {region: 0x164, script: 0x52, flags: 0x0},
+	722:  {region: 0x164, script: 0x52, flags: 0x0},
+	723:  {region: 0x164, script: 0x52, flags: 0x0},
+	724:  {region: 0x164, script: 0x52, flags: 0x0},
+	725:  {region: 0x164, script: 0x52, flags: 0x0},
+	726:  {region: 0x164, script: 0x5, flags: 0x0},
+	727:  {region: 0x105, script: 0x1e, flags: 0x0},
+	728:  {region: 0xe6, script: 0x52, flags: 0x0},
+	729:  {region: 0x164, script: 0x52, flags: 0x0},
+	730:  {region: 0x94, script: 0x52, flags: 0x0},
+	731:  {region: 0x164, script: 0x27, flags: 0x0},
+	732:  {region: 0x164, script: 0x52, flags: 0x0},
+	733:  {region: 0x164, script: 0x52, flags: 0x0},
+	734:  {region: 0x164, script: 0x52, flags: 0x0},
+	735:  {region: 0x111, script: 0x52, flags: 0x0},
+	736:  {region: 0xa3, script: 0x52, flags: 0x0},
+	737:  {region: 0x164, script: 0x52, flags: 0x0},
+	738:  {region: 0x164, script: 0x52, flags: 0x0},
+	739:  {region: 0x122, script: 0x5, flags: 0x0},
+	740:  {region: 0xcb, script: 0x52, flags: 0x0},
+	741:  {region: 0x164, script: 0x52, flags: 0x0},
+	742:  {region: 0x164, script: 0x52, flags: 0x0},
+	743:  {region: 0x164, script: 0x52, flags: 0x0},
+	744:  {region: 0xbe, script: 0x52, flags: 0x0},
+	745:  {region: 0xd0, script: 0x52, flags: 0x0},
+	746:  {region: 0x164, script: 0x52, flags: 0x0},
+	747:  {region: 0x51, script: 0x52, flags: 0x0},
+	748:  {region: 0xda, script: 0x20, flags: 0x0},
+	749:  {region: 0x12e, script: 0x52, flags: 0x0},
+	750:  {region: 0xbf, script: 0x52, flags: 0x0},
+	751:  {region: 0x164, script: 0x52, flags: 0x0},
+	752:  {region: 0x164, script: 0x52, flags: 0x0},
+	753:  {region: 0xdf, script: 0x52, flags: 0x0},
+	754:  {region: 0x164, script: 0x52, flags: 0x0},
+	755:  {region: 0x94, script: 0x52, flags: 0x0},
+	756:  {region: 0x9a, script: 0x36, flags: 0x0},
+	757:  {region: 0x164, script: 0x52, flags: 0x0},
+	758:  {region: 0xc1, script: 0x1e, flags: 0x0},
+	759:  {region: 0x164, script: 0x5, flags: 0x0},
+	760:  {region: 0x164, script: 0x52, flags: 0x0},
+	761:  {region: 0x164, script: 0x52, flags: 0x0},
+	762:  {region: 0x164, script: 0x52, flags: 0x0},
+	763:  {region: 0x98, script: 0x64, flags: 0x0},
+	764:  {region: 0x164, script: 0x52, flags: 0x0},
+	765:  {region: 0x164, script: 0x52, flags: 0x0},
+	766:  {region: 0x10a, script: 0x52, flags: 0x0},
+	767:  {region: 0x164, script: 0x52, flags: 0x0},
+	768:  {region: 0x164, script: 0x52, flags: 0x0},
+	769:  {region: 0x164, script: 0x52, flags: 0x0},
+	770:  {region: 0x28, script: 0x3, flags: 0x1},
+	771:  {region: 0x164, script: 0x52, flags: 0x0},
+	772:  {region: 0x164, script: 0x52, flags: 0x0},
+	773:  {region: 0x98, script: 0xe, flags: 0x0},
+	774:  {region: 0xc3, script: 0x6b, flags: 0x0},
+	776:  {region: 0x164, script: 0x52, flags: 0x0},
+	777:  {region: 0x48, script: 0x52, flags: 0x0},
+	778:  {region: 0x48, script: 0x52, flags: 0x0},
+	779:  {region: 0x36, script: 0x52, flags: 0x0},
+	780:  {region: 0x164, script: 0x52, flags: 0x0},
+	781:  {region: 0x164, script: 0x52, flags: 0x0},
+	782:  {region: 0x164, script: 0x52, flags: 0x0},
+	783:  {region: 0x164, script: 0x52, flags: 0x0},
+	784:  {region: 0x164, script: 0x52, flags: 0x0},
+	785:  {region: 0x164, script: 0x52, flags: 0x0},
+	786:  {region: 0x98, script: 0x20, flags: 0x0},
+	787:  {region: 0xda, script: 0x20, flags: 0x0},
+	788:  {region: 0x105, script: 0x1e, flags: 0x0},
+	789:  {region: 0x34, script: 0x68, flags: 0x0},
+	790:  {region: 0x2b, script: 0x3, flags: 0x1},
+	791:  {region: 0xca, script: 0x52, flags: 0x0},
+	792:  {region: 0x164, script: 0x52, flags: 0x0},
+	793:  {region: 0x164, script: 0x52, flags: 0x0},
+	794:  {region: 0x164, script: 0x52, flags: 0x0},
+	795:  {region: 0x98, script: 0x20, flags: 0x0},
+	796:  {region: 0x51, script: 0x52, flags: 0x0},
+	798:  {region: 0x164, script: 0x52, flags: 0x0},
+	799:  {region: 0x134, script: 0x52, flags: 0x0},
+	800:  {region: 0x164, script: 0x52, flags: 0x0},
+	801:  {region: 0x164, script: 0x52, flags: 0x0},
+	802:  {region: 0xe7, script: 0x5, flags: 0x0},
+	803:  {region: 0xc2, script: 0x52, flags: 0x0},
+	804:  {region: 0x98, script: 0x20, flags: 0x0},
+	805:  {region: 0x94, script: 0x52, flags: 0x0},
+	806:  {region: 0x163, script: 0x52, flags: 0x0},
+	807:  {region: 0x164, script: 0x52, flags: 0x0},
+	808:  {region: 0xc3, script: 0x6b, flags: 0x0},
+	809:  {region: 0x164, script: 0x52, flags: 0x0},
+	810:  {region: 0x164, script: 0x27, flags: 0x0},
+	811:  {region: 0x105, script: 0x1e, flags: 0x0},
+	812:  {region: 0x164, script: 0x52, flags: 0x0},
+	813:  {region: 0x130, script: 0x52, flags: 0x0},
+	814:  {region: 0x9b, script: 0x5d, flags: 0x0},
+	815:  {region: 0x164, script: 0x52, flags: 0x0},
+	816:  {region: 0x164, script: 0x52, flags: 0x0},
+	817:  {region: 0x9b, script: 0x5, flags: 0x0},
+	818:  {region: 0x164, script: 0x52, flags: 0x0},
+	819:  {region: 0x164, script: 0x52, flags: 0x0},
+	820:  {region: 0x164, script: 0x52, flags: 0x0},
+	821:  {region: 0xdc, script: 0x52, flags: 0x0},
+	822:  {region: 0x164, script: 0x52, flags: 0x0},
+	823:  {region: 0x164, script: 0x52, flags: 0x0},
+	825:  {region: 0x164, script: 0x52, flags: 0x0},
+	826:  {region: 0x52, script: 0x34, flags: 0x0},
+	827:  {region: 0x9d, script: 0x52, flags: 0x0},
+	828:  {region: 0xd1, script: 0x52, flags: 0x0},
+	829:  {region: 0x164, script: 0x52, flags: 0x0},
+	830:  {region: 0xd9, script: 0x52, flags: 0x0},
+	831:  {region: 0x164, script: 0x52, flags: 0x0},
+	832:  {region: 0x164, script: 0x52, flags: 0x0},
+	833:  {region: 0x164, script: 0x52, flags: 0x0},
+	834:  {region: 0xce, script: 0x52, flags: 0x0},
+	835:  {region: 0x164, script: 0x52, flags: 0x0},
+	836:  {region: 0x164, script: 0x52, flags: 0x0},
+	837:  {region: 0x163, script: 0x52, flags: 0x0},
+	838:  {region: 0xd0, script: 0x52, flags: 0x0},
+	839:  {region: 0x5f, script: 0x52, flags: 0x0},
+	840:  {region: 0xda, script: 0x20, flags: 0x0},
+	841:  {region: 0x164, script: 0x52, flags: 0x0},
+	842:  {region: 0xda, script: 0x20, flags: 0x0},
+	843:  {region: 0x164, script: 0x52, flags: 0x0},
+	844:  {region: 0x164, script: 0x52, flags: 0x0},
+	845:  {region: 0xd1, script: 0x52, flags: 0x0},
+	846:  {region: 0x164, script: 0x52, flags: 0x0},
+	847:  {region: 0x164, script: 0x52, flags: 0x0},
+	848:  {region: 0xd0, script: 0x52, flags: 0x0},
+	849:  {region: 0x164, script: 0x52, flags: 0x0},
+	850:  {region: 0xce, script: 0x52, flags: 0x0},
+	851:  {region: 0xce, script: 0x52, flags: 0x0},
+	852:  {region: 0x164, script: 0x52, flags: 0x0},
+	853:  {region: 0x164, script: 0x52, flags: 0x0},
+	854:  {region: 0x94, script: 0x52, flags: 0x0},
+	855:  {region: 0x164, script: 0x52, flags: 0x0},
+	856:  {region: 0xde, script: 0x52, flags: 0x0},
+	857:  {region: 0x164, script: 0x52, flags: 0x0},
+	858:  {region: 0x164, script: 0x52, flags: 0x0},
+	859:  {region: 0x98, script: 0x52, flags: 0x0},
+	860:  {region: 0x164, script: 0x52, flags: 0x0},
+	861:  {region: 0x164, script: 0x52, flags: 0x0},
+	862:  {region: 0xd8, script: 0x52, flags: 0x0},
+	863:  {region: 0x51, script: 0x52, flags: 0x0},
+	864:  {region: 0x164, script: 0x52, flags: 0x0},
+	865:  {region: 0xd9, script: 0x52, flags: 0x0},
+	866:  {region: 0x164, script: 0x52, flags: 0x0},
+	867:  {region: 0x51, script: 0x52, flags: 0x0},
+	868:  {region: 0x164, script: 0x52, flags: 0x0},
+	869:  {region: 0x164, script: 0x52, flags: 0x0},
+	870:  {region: 0xd9, script: 0x52, flags: 0x0},
+	871:  {region: 0x122, script: 0x4e, flags: 0x0},
+	872:  {region: 0x98, script: 0x20, flags: 0x0},
+	873:  {region: 0x10b, script: 0xb7, flags: 0x0},
+	874:  {region: 0x164, script: 0x52, flags: 0x0},
+	875:  {region: 0x164, script: 0x52, flags: 0x0},
+	876:  {region: 0x83, script: 0x70, flags: 0x0},
+	877:  {region: 0x160, script: 0x52, flags: 0x0},
+	878:  {region: 0x164, script: 0x52, flags: 0x0},
+	879:  {region: 0x48, script: 0x17, flags: 0x0},
+	880:  {region: 0x164, script: 0x52, flags: 0x0},
+	881:  {region: 0x160, script: 0x52, flags: 0x0},
+	882:  {region: 0x164, script: 0x52, flags: 0x0},
+	883:  {region: 0x164, script: 0x52, flags: 0x0},
+	884:  {region: 0x164, script: 0x52, flags: 0x0},
+	885:  {region: 0x164, script: 0x52, flags: 0x0},
+	886:  {region: 0x164, script: 0x52, flags: 0x0},
+	887:  {region: 0x116, script: 0x52, flags: 0x0},
+	888:  {region: 0x164, script: 0x52, flags: 0x0},
+	889:  {region: 0x164, script: 0x52, flags: 0x0},
+	890:  {region: 0x134, script: 0x52, flags: 0x0},
+	891:  {region: 0x164, script: 0x52, flags: 0x0},
+	892:  {region: 0x52, script: 0x52, flags: 0x0},
+	893:  {region: 0x164, script: 0x52, flags: 0x0},
+	894:  {region: 0xcd, script: 0x52, flags: 0x0},
+	895:  {region: 0x12e, script: 0x52, flags: 0x0},
+	896:  {region: 0x130, script: 0x52, flags: 0x0},
+	897:  {region: 0x7f, script: 0x52, flags: 0x0},
+	898:  {region: 0x77, script: 0x52, flags: 0x0},
+	899:  {region: 0x164, script: 0x52, flags: 0x0},
+	901:  {region: 0x164, script: 0x52, flags: 0x0},
+	902:  {region: 0x164, script: 0x52, flags: 0x0},
+	903:  {region: 0x6e, script: 0x52, flags: 0x0},
+	904:  {region: 0x164, script: 0x52, flags: 0x0},
+	905:  {region: 0x164, script: 0x52, flags: 0x0},
+	906:  {region: 0x164, script: 0x52, flags: 0x0},
+	907:  {region: 0x164, script: 0x52, flags: 0x0},
+	908:  {region: 0x98, script: 0x75, flags: 0x0},
+	909:  {region: 0x164, script: 0x52, flags: 0x0},
+	910:  {region: 0x164, script: 0x5, flags: 0x0},
+	911:  {region: 0x7c, script: 0x1e, flags: 0x0},
+	912:  {region: 0x134, script: 0x76, flags: 0x0},
+	913:  {region: 0x164, script: 0x5, flags: 0x0},
+	914:  {region: 0xc4, script: 0x74, flags: 0x0},
+	915:  {region: 0x164, script: 0x52, flags: 0x0},
+	916:  {region: 0x2e, script: 0x3, flags: 0x1},
+	917:  {region: 0xe6, script: 0x52, flags: 0x0},
+	918:  {region: 0x31, script: 0x2, flags: 0x1},
+	919:  {region: 0xe6, script: 0x52, flags: 0x0},
+	920:  {region: 0x2f, script: 0x52, flags: 0x0},
+	921:  {region: 0xef, script: 0x52, flags: 0x0},
+	922:  {region: 0x164, script: 0x52, flags: 0x0},
+	923:  {region: 0x77, script: 0x52, flags: 0x0},
+	924:  {region: 0xd5, script: 0x52, flags: 0x0},
+	925:  {region: 0x134, script: 0x52, flags: 0x0},
+	926:  {region: 0x48, script: 0x52, flags: 0x0},
+	927:  {region: 0x164, script: 0x52, flags: 0x0},
+	928:  {region: 0x9b, script: 0xdd, flags: 0x0},
+	929:  {region: 0x164, script: 0x52, flags: 0x0},
+	930:  {region: 0x5f, script: 0x52, flags: 0x0},
+	931:  {region: 0x164, script: 0x5, flags: 0x0},
+	932:  {region: 0xaf, script: 0x7f, flags: 0x0},
+	934:  {region: 0x164, script: 0x52, flags: 0x0},
+	935:  {region: 0x164, script: 0x52, flags: 0x0},
+	936:  {region: 0x98, script: 0x12, flags: 0x0},
+	937:  {region: 0xa3, script: 0x52, flags: 0x0},
+	938:  {region: 0xe8, script: 0x52, flags: 0x0},
+	939:  {region: 0x164, script: 0x52, flags: 0x0},
+	940:  {region: 0x9d, script: 0x52, flags: 0x0},
+	941:  {region: 0x164, script: 0x52, flags: 0x0},
+	942:  {region: 0x164, script: 0x52, flags: 0x0},
+	943:  {region: 0x86, script: 0x2d, flags: 0x0},
+	944:  {region: 0x74, script: 0x52, flags: 0x0},
+	945:  {region: 0x164, script: 0x52, flags: 0x0},
+	946:  {region: 0xe7, script: 0x45, flags: 0x0},
+	947:  {region: 0x9b, script: 0x5, flags: 0x0},
+	948:  {region: 0x1, script: 0x52, flags: 0x0},
+	949:  {region: 0x23, script: 0x5, flags: 0x0},
+	950:  {region: 0x164, script: 0x52, flags: 0x0},
+	951:  {region: 0x40, script: 0x52, flags: 0x0},
+	952:  {region: 0x164, script: 0x52, flags: 0x0},
+	953:  {region: 0x79, script: 0x52, flags: 0x0},
+	954:  {region: 0x164, script: 0x52, flags: 0x0},
+	955:  {region: 0xe3, script: 0x52, flags: 0x0},
+	956:  {region: 0x88, script: 0x52, flags: 0x0},
+	957:  {region: 0x68, script: 0x52, flags: 0x0},
+	958:  {region: 0x164, script: 0x52, flags: 0x0},
+	959:  {region: 0x98, script: 0x20, flags: 0x0},
+	960:  {region: 0x164, script: 0x52, flags: 0x0},
+	961:  {region: 0x101, script: 0x52, flags: 0x0},
+	962:  {region: 0x94, script: 0x52, flags: 0x0},
+	963:  {region: 0x164, script: 0x52, flags: 0x0},
+	964:  {region: 0x164, script: 0x52, flags: 0x0},
+	965:  {region: 0x9d, script: 0x52, flags: 0x0},
+	966:  {region: 0x164, script: 0x5, flags: 0x0},
+	967:  {region: 0x98, script: 0x52, flags: 0x0},
+	968:  {region: 0x33, script: 0x2, flags: 0x1},
+	969:  {region: 0xda, script: 0x20, flags: 0x0},
+	970:  {region: 0x34, script: 0xe, flags: 0x0},
+	971:  {region: 0x4d, script: 0x52, flags: 0x0},
+	972:  {region: 0x71, script: 0x52, flags: 0x0},
+	973:  {region: 0x4d, script: 0x52, flags: 0x0},
+	974:  {region: 0x9b, script: 0x5, flags: 0x0},
+	975:  {region: 0x10b, script: 0x52, flags: 0x0},
+	976:  {region: 0x39, script: 0x52, flags: 0x0},
+	977:  {region: 0x164, script: 0x52, flags: 0x0},
+	978:  {region: 0xd0, script: 0x52, flags: 0x0},
+	979:  {region: 0x103, script: 0x52, flags: 0x0},
+	980:  {region: 0x94, script: 0x52, flags: 0x0},
+	981:  {region: 0x12e, script: 0x52, flags: 0x0},
+	982:  {region: 0x164, script: 0x52, flags: 0x0},
+	983:  {region: 0x164, script: 0x52, flags: 0x0},
+	984:  {region: 0x72, script: 0x52, flags: 0x0},
+	985:  {region: 0x105, script: 0x1e, flags: 0x0},
+	986:  {region: 0x12f, script: 0x1e, flags: 0x0},
+	987:  {region: 0x108, script: 0x52, flags: 0x0},
+	988:  {region: 0x106, script: 0x52, flags: 0x0},
+	989:  {region: 0x12e, script: 0x52, flags: 0x0},
+	990:  {region: 0x164, script: 0x52, flags: 0x0},
+	991:  {region: 0xa1, script: 0x44, flags: 0x0},
+	992:  {region: 0x98, script: 0x20, flags: 0x0},
+	993:  {region: 0x7f, script: 0x52, flags: 0x0},
+	994:  {region: 0x105, script: 0x1e, flags: 0x0},
+	995:  {region: 0xa3, script: 0x52, flags: 0x0},
+	996:  {region: 0x94, script: 0x52, flags: 0x0},
+	997:  {region: 0x98, script: 0x52, flags: 0x0},
+	998:  {region: 0x98, script: 0xbb, flags: 0x0},
+	999:  {region: 0x164, script: 0x52, flags: 0x0},
+	1000: {region: 0x164, script: 0x52, flags: 0x0},
+	1001: {region: 0x12e, script: 0x52, flags: 0x0},
+	1002: {region: 0x9d, script: 0x52, flags: 0x0},
+	1003: {region: 0x98, script: 0x20, flags: 0x0},
+	1004: {region: 0x164, script: 0x5, flags: 0x0},
+	1005: {region: 0x9d, script: 0x52, flags: 0x0},
+	1006: {region: 0x7a, script: 0x52, flags: 0x0},
+	1007: {region: 0x48, script: 0x52, flags: 0x0},
+	1008: {region: 0x35, script: 0x4, flags: 0x1},
+	1009: {region: 0x9d, script: 0x52, flags: 0x0},
+	1010: {region: 0x9b, script: 0x5, flags: 0x0},
+	1011: {region: 0xd9, script: 0x52, flags: 0x0},
+	1012: {region: 0x4e, script: 0x52, flags: 0x0},
+	1013: {region: 0xd0, script: 0x52, flags: 0x0},
+	1014: {region: 0xce, script: 0x52, flags: 0x0},
+	1015: {region: 0xc2, script: 0x52, flags: 0x0},
+	1016: {region: 0x4b, script: 0x52, flags: 0x0},
+	1017: {region: 0x95, script: 0x72, flags: 0x0},
+	1018: {region: 0xb5, script: 0x52, flags: 0x0},
+	1019: {region: 0x164, script: 0x27, flags: 0x0},
+	1020: {region: 0x164, script: 0x52, flags: 0x0},
+	1022: {region: 0xb9, script: 0xd2, flags: 0x0},
+	1023: {region: 0x164, script: 0x52, flags: 0x0},
+	1024: {region: 0xc3, script: 0x6b, flags: 0x0},
+	1025: {region: 0x164, script: 0x5, flags: 0x0},
+	1026: {region: 0xb2, script: 0xc1, flags: 0x0},
+	1027: {region: 0x6e, script: 0x52, flags: 0x0},
+	1028: {region: 0x164, script: 0x52, flags: 0x0},
+	1029: {region: 0x164, script: 0x52, flags: 0x0},
+	1030: {region: 0x164, script: 0x52, flags: 0x0},
+	1031: {region: 0x164, script: 0x52, flags: 0x0},
+	1032: {region: 0x110, script: 0x52, flags: 0x0},
+	1033: {region: 0x164, script: 0x52, flags: 0x0},
+	1034: {region: 0xe7, script: 0x5, flags: 0x0},
+	1035: {region: 0x164, script: 0x52, flags: 0x0},
+	1036: {region: 0x10e, script: 0x52, flags: 0x0},
+	1037: {region: 0x164, script: 0x52, flags: 0x0},
+	1038: {region: 0xe8, script: 0x52, flags: 0x0},
+	1039: {region: 0x164, script: 0x52, flags: 0x0},
+	1040: {region: 0x94, script: 0x52, flags: 0x0},
+	1041: {region: 0x141, script: 0x52, flags: 0x0},
+	1042: {region: 0x10b, script: 0x52, flags: 0x0},
+	1044: {region: 0x10b, script: 0x52, flags: 0x0},
+	1045: {region: 0x71, script: 0x52, flags: 0x0},
+	1046: {region: 0x96, script: 0xb8, flags: 0x0},
+	1047: {region: 0x164, script: 0x52, flags: 0x0},
+	1048: {region: 0x71, script: 0x52, flags: 0x0},
+	1049: {region: 0x163, script: 0x52, flags: 0x0},
+	1050: {region: 0x164, script: 0x52, flags: 0x0},
+	1051: {region: 0xc2, script: 0x52, flags: 0x0},
+	1052: {region: 0x164, script: 0x52, flags: 0x0},
+	1053: {region: 0x164, script: 0x52, flags: 0x0},
+	1054: {region: 0x164, script: 0x52, flags: 0x0},
+	1055: {region: 0x114, script: 0x52, flags: 0x0},
+	1056: {region: 0x164, script: 0x52, flags: 0x0},
+	1057: {region: 0x164, script: 0x52, flags: 0x0},
+	1058: {region: 0x122, script: 0xd5, flags: 0x0},
+	1059: {region: 0x164, script: 0x52, flags: 0x0},
+	1060: {region: 0x164, script: 0x52, flags: 0x0},
+	1061: {region: 0x164, script: 0x52, flags: 0x0},
+	1062: {region: 0x164, script: 0x52, flags: 0x0},
+	1063: {region: 0x26, script: 0x52, flags: 0x0},
+	1064: {region: 0x39, script: 0x5, flags: 0x1},
+	1065: {region: 0x98, script: 0xc2, flags: 0x0},
+	1066: {region: 0x115, script: 0x52, flags: 0x0},
+	1067: {region: 0x113, script: 0x52, flags: 0x0},
+	1068: {region: 0x98, script: 0x20, flags: 0x0},
+	1069: {region: 0x160, script: 0x52, flags: 0x0},
+	1070: {region: 0x164, script: 0x52, flags: 0x0},
+	1071: {region: 0x164, script: 0x52, flags: 0x0},
+	1072: {region: 0x6c, script: 0x52, flags: 0x0},
+	1073: {region: 0x160, script: 0x52, flags: 0x0},
+	1074: {region: 0x164, script: 0x52, flags: 0x0},
+	1075: {region: 0x5f, script: 0x52, flags: 0x0},
+	1076: {region: 0x94, script: 0x52, flags: 0x0},
+	1077: {region: 0x164, script: 0x52, flags: 0x0},
+	1078: {region: 0x164, script: 0x52, flags: 0x0},
+	1079: {region: 0x12e, script: 0x52, flags: 0x0},
+	1080: {region: 0x164, script: 0x52, flags: 0x0},
+	1081: {region: 0x83, script: 0x52, flags: 0x0},
+	1082: {region: 0x10b, script: 0x52, flags: 0x0},
+	1083: {region: 0x12e, script: 0x52, flags: 0x0},
+	1084: {region: 0x15e, script: 0x5, flags: 0x0},
+	1085: {region: 0x4a, script: 0x52, flags: 0x0},
+	1086: {region: 0x5f, script: 0x52, flags: 0x0},
+	1087: {region: 0x164, script: 0x52, flags: 0x0},
+	1088: {region: 0x98, script: 0x20, flags: 0x0},
+	1089: {region: 0x94, script: 0x52, flags: 0x0},
+	1090: {region: 0x164, script: 0x52, flags: 0x0},
+	1091: {region: 0x34, script: 0xe, flags: 0x0},
+	1092: {region: 0x9a, script: 0xc5, flags: 0x0},
+	1093: {region: 0xe8, script: 0x52, flags: 0x0},
+	1094: {region: 0x98, script: 0xcd, flags: 0x0},
+	1095: {region: 0xda, script: 0x20, flags: 0x0},
+	1096: {region: 0x164, script: 0x52, flags: 0x0},
+	1097: {region: 0x164, script: 0x52, flags: 0x0},
+	1098: {region: 0x164, script: 0x52, flags: 0x0},
+	1099: {region: 0x164, script: 0x52, flags: 0x0},
+	1100: {region: 0x164, script: 0x52, flags: 0x0},
+	1101: {region: 0x164, script: 0x52, flags: 0x0},
+	1102: {region: 0x164, script: 0x52, flags: 0x0},
+	1103: {region: 0x164, script: 0x52, flags: 0x0},
+	1104: {region: 0xe6, script: 0x52, flags: 0x0},
+	1105: {region: 0x164, script: 0x52, flags: 0x0},
+	1106: {region: 0x164, script: 0x52, flags: 0x0},
+	1107: {region: 0x98, script: 0x4a, flags: 0x0},
+	1108: {region: 0x52, script: 0xcb, flags: 0x0},
+	1109: {region: 0xda, script: 0x20, flags: 0x0},
+	1110: {region: 0xda, script: 0x20, flags: 0x0},
+	1111: {region: 0x98, script: 0xd0, flags: 0x0},
+	1112: {region: 0x164, script: 0x52, flags: 0x0},
+	1113: {region: 0x111, script: 0x52, flags: 0x0},
+	1114: {region: 0x130, script: 0x52, flags: 0x0},
+	1115: {region: 0x125, script: 0x52, flags: 0x0},
+	1116: {region: 0x164, script: 0x52, flags: 0x0},
+	1117: {region: 0x3e, script: 0x3, flags: 0x1},
+	1118: {region: 0x164, script: 0x52, flags: 0x0},
+	1119: {region: 0x164, script: 0x52, flags: 0x0},
+	1120: {region: 0x164, script: 0x52, flags: 0x0},
+	1121: {region: 0x122, script: 0xd5, flags: 0x0},
+	1122: {region: 0xda, script: 0x20, flags: 0x0},
+	1123: {region: 0xda, script: 0x20, flags: 0x0},
+	1124: {region: 0xda, script: 0x20, flags: 0x0},
+	1125: {region: 0x6e, script: 0x27, flags: 0x0},
+	1126: {region: 0x164, script: 0x52, flags: 0x0},
+	1127: {region: 0x6c, script: 0x27, flags: 0x0},
+	1128: {region: 0x164, script: 0x52, flags: 0x0},
+	1129: {region: 0x164, script: 0x52, flags: 0x0},
+	1130: {region: 0x164, script: 0x52, flags: 0x0},
+	1131: {region: 0xd5, script: 0x52, flags: 0x0},
+	1132: {region: 0x126, script: 0x52, flags: 0x0},
+	1133: {region: 0x124, script: 0x52, flags: 0x0},
+	1134: {region: 0x31, script: 0x52, flags: 0x0},
+	1135: {region: 0xda, script: 0x20, flags: 0x0},
+	1136: {region: 0xe6, script: 0x52, flags: 0x0},
+	1137: {region: 0x164, script: 0x52, flags: 0x0},
+	1138: {region: 0x164, script: 0x52, flags: 0x0},
+	1139: {region: 0x31, script: 0x52, flags: 0x0},
+	1140: {region: 0xd3, script: 0x52, flags: 0x0},
+	1141: {region: 0x164, script: 0x52, flags: 0x0},
+	1142: {region: 0x160, script: 0x52, flags: 0x0},
+	1143: {region: 0x164, script: 0x52, flags: 0x0},
+	1144: {region: 0x128, script: 0x52, flags: 0x0},
+	1145: {region: 0x164, script: 0x52, flags: 0x0},
+	1146: {region: 0xcd, script: 0x52, flags: 0x0},
+	1147: {region: 0x164, script: 0x52, flags: 0x0},
+	1148: {region: 0xe5, script: 0x52, flags: 0x0},
+	1149: {region: 0x164, script: 0x52, flags: 0x0},
+	1150: {region: 0x164, script: 0x52, flags: 0x0},
+	1151: {region: 0x164, script: 0x52, flags: 0x0},
+	1152: {region: 0x12a, script: 0x52, flags: 0x0},
+	1153: {region: 0x12a, script: 0x52, flags: 0x0},
+	1154: {region: 0x12d, script: 0x52, flags: 0x0},
+	1155: {region: 0x164, script: 0x5, flags: 0x0},
+	1156: {region: 0x160, script: 0x52, flags: 0x0},
+	1157: {region: 0x86, script: 0x2d, flags: 0x0},
+	1158: {region: 0xda, script: 0x20, flags: 0x0},
+	1159: {region: 0xe6, script: 0x52, flags: 0x0},
+	1160: {region: 0x42, script: 0xd6, flags: 0x0},
+	1161: {region: 0x164, script: 0x52, flags: 0x0},
+	1162: {region: 0x105, script: 0x1e, flags: 0x0},
+	1163: {region: 0x164, script: 0x52, flags: 0x0},
+	1164: {region: 0x164, script: 0x52, flags: 0x0},
+	1165: {region: 0x130, script: 0x52, flags: 0x0},
+	1166: {region: 0x164, script: 0x52, flags: 0x0},
+	1167: {region: 0x122, script: 0xd5, flags: 0x0},
+	1168: {region: 0x31, script: 0x52, flags: 0x0},
+	1169: {region: 0x164, script: 0x52, flags: 0x0},
+	1170: {region: 0x164, script: 0x52, flags: 0x0},
+	1171: {region: 0xcd, script: 0x52, flags: 0x0},
+	1172: {region: 0x164, script: 0x52, flags: 0x0},
+	1173: {region: 0x164, script: 0x52, flags: 0x0},
+	1174: {region: 0x12c, script: 0x52, flags: 0x0},
+	1175: {region: 0x164, script: 0x52, flags: 0x0},
+	1177: {region: 0x164, script: 0x52, flags: 0x0},
+	1178: {region: 0xd3, script: 0x52, flags: 0x0},
+	1179: {region: 0x52, script: 0xce, flags: 0x0},
+	1180: {region: 0xe4, script: 0x52, flags: 0x0},
+	1181: {region: 0x164, script: 0x52, flags: 0x0},
+	1182: {region: 0x105, script: 0x1e, flags: 0x0},
+	1183: {region: 0xb9, script: 0x52, flags: 0x0},
+	1184: {region: 0x164, script: 0x52, flags: 0x0},
+	1185: {region: 0x105, script: 0x1e, flags: 0x0},
+	1186: {region: 0x41, script: 0x4, flags: 0x1},
+	1187: {region: 0x11b, script: 0xd8, flags: 0x0},
+	1188: {region: 0x12f, script: 0x1e, flags: 0x0},
+	1189: {region: 0x74, script: 0x52, flags: 0x0},
+	1190: {region: 0x29, script: 0x52, flags: 0x0},
+	1192: {region: 0x45, script: 0x3, flags: 0x1},
+	1193: {region: 0x98, script: 0xe, flags: 0x0},
+	1194: {region: 0xe7, script: 0x5, flags: 0x0},
+	1195: {region: 0x164, script: 0x52, flags: 0x0},
+	1196: {region: 0x164, script: 0x52, flags: 0x0},
+	1197: {region: 0x164, script: 0x52, flags: 0x0},
+	1198: {region: 0x164, script: 0x52, flags: 0x0},
+	1199: {region: 0x164, script: 0x52, flags: 0x0},
+	1200: {region: 0x164, script: 0x52, flags: 0x0},
+	1201: {region: 0x164, script: 0x52, flags: 0x0},
+	1202: {region: 0x48, script: 0x4, flags: 0x1},
+	1203: {region: 0x164, script: 0x52, flags: 0x0},
+	1204: {region: 0xb3, script: 0xd9, flags: 0x0},
+	1205: {region: 0x164, script: 0x52, flags: 0x0},
+	1206: {region: 0x160, script: 0x52, flags: 0x0},
+	1207: {region: 0x9d, script: 0x52, flags: 0x0},
+	1208: {region: 0x105, script: 0x52, flags: 0x0},
+	1209: {region: 0x13d, script: 0x52, flags: 0x0},
+	1210: {region: 0x11a, script: 0x52, flags: 0x0},
+	1211: {region: 0x164, script: 0x52, flags: 0x0},
+	1212: {region: 0x35, script: 0x52, flags: 0x0},
+	1213: {region: 0x5f, script: 0x52, flags: 0x0},
+	1214: {region: 0xd0, script: 0x52, flags: 0x0},
+	1215: {region: 0x1, script: 0x52, flags: 0x0},
+	1216: {region: 0x105, script: 0x52, flags: 0x0},
+	1217: {region: 0x69, script: 0x52, flags: 0x0},
+	1218: {region: 0x12e, script: 0x52, flags: 0x0},
+	1219: {region: 0x164, script: 0x52, flags: 0x0},
+	1220: {region: 0x35, script: 0x52, flags: 0x0},
+	1221: {region: 0x4d, script: 0x52, flags: 0x0},
+	1222: {region: 0x164, script: 0x52, flags: 0x0},
+	1223: {region: 0x6e, script: 0x27, flags: 0x0},
+	1224: {region: 0x164, script: 0x52, flags: 0x0},
+	1225: {region: 0xe6, script: 0x52, flags: 0x0},
+	1226: {region: 0x2e, script: 0x52, flags: 0x0},
+	1227: {region: 0x98, script: 0xd0, flags: 0x0},
+	1228: {region: 0x98, script: 0x20, flags: 0x0},
+	1229: {region: 0x164, script: 0x52, flags: 0x0},
+	1230: {region: 0x164, script: 0x52, flags: 0x0},
+	1231: {region: 0x164, script: 0x52, flags: 0x0},
+	1232: {region: 0x164, script: 0x52, flags: 0x0},
+	1233: {region: 0x164, script: 0x52, flags: 0x0},
+	1234: {region: 0x164, script: 0x52, flags: 0x0},
+	1235: {region: 0x164, script: 0x52, flags: 0x0},
+	1236: {region: 0x164, script: 0x52, flags: 0x0},
+	1237: {region: 0x164, script: 0x52, flags: 0x0},
+	1238: {region: 0x13f, script: 0x52, flags: 0x0},
+	1239: {region: 0x164, script: 0x52, flags: 0x0},
+	1240: {region: 0x164, script: 0x52, flags: 0x0},
+	1241: {region: 0xa7, script: 0x5, flags: 0x0},
+	1242: {region: 0x164, script: 0x52, flags: 0x0},
+	1243: {region: 0x113, script: 0x52, flags: 0x0},
+	1244: {region: 0x164, script: 0x52, flags: 0x0},
+	1245: {region: 0x164, script: 0x52, flags: 0x0},
+	1246: {region: 0x164, script: 0x52, flags: 0x0},
+	1247: {region: 0x164, script: 0x52, flags: 0x0},
+	1248: {region: 0x98, script: 0x20, flags: 0x0},
+	1249: {region: 0x52, script: 0x34, flags: 0x0},
+	1250: {region: 0x164, script: 0x52, flags: 0x0},
+	1251: {region: 0x164, script: 0x52, flags: 0x0},
+	1252: {region: 0x40, script: 0x52, flags: 0x0},
+	1253: {region: 0x164, script: 0x52, flags: 0x0},
+	1254: {region: 0x12a, script: 0x18, flags: 0x0},
+	1255: {region: 0x164, script: 0x52, flags: 0x0},
+	1256: {region: 0x160, script: 0x52, flags: 0x0},
+	1257: {region: 0x164, script: 0x52, flags: 0x0},
+	1258: {region: 0x12a, script: 0x5a, flags: 0x0},
+	1259: {region: 0x12a, script: 0x5b, flags: 0x0},
+	1260: {region: 0x7c, script: 0x29, flags: 0x0},
+	1261: {region: 0x52, script: 0x5e, flags: 0x0},
+	1262: {region: 0x10a, script: 0x62, flags: 0x0},
+	1263: {region: 0x107, script: 0x6c, flags: 0x0},
+	1264: {region: 0x98, script: 0x20, flags: 0x0},
+	1265: {region: 0x130, script: 0x52, flags: 0x0},
+	1266: {region: 0x164, script: 0x52, flags: 0x0},
+	1267: {region: 0x9b, script: 0x82, flags: 0x0},
+	1268: {region: 0x164, script: 0x52, flags: 0x0},
+	1269: {region: 0x15d, script: 0xba, flags: 0x0},
+	1270: {region: 0x164, script: 0x52, flags: 0x0},
+	1271: {region: 0x164, script: 0x52, flags: 0x0},
+	1272: {region: 0xda, script: 0x20, flags: 0x0},
+	1273: {region: 0x164, script: 0x52, flags: 0x0},
+	1274: {region: 0x164, script: 0x52, flags: 0x0},
+	1275: {region: 0xd0, script: 0x52, flags: 0x0},
+	1276: {region: 0x74, script: 0x52, flags: 0x0},
+	1277: {region: 0x164, script: 0x52, flags: 0x0},
+	1278: {region: 0x164, script: 0x52, flags: 0x0},
+	1279: {region: 0x51, script: 0x52, flags: 0x0},
+	1280: {region: 0x164, script: 0x52, flags: 0x0},
+	1281: {region: 0x164, script: 0x52, flags: 0x0},
+	1282: {region: 0x164, script: 0x52, flags: 0x0},
+	1283: {region: 0x51, script: 0x52, flags: 0x0},
+	1284: {region: 0x164, script: 0x52, flags: 0x0},
+	1285: {region: 0x164, script: 0x52, flags: 0x0},
+	1286: {region: 0x164, script: 0x52, flags: 0x0},
+	1287: {region: 0x164, script: 0x52, flags: 0x0},
+	1288: {region: 0x1, script: 0x37, flags: 0x0},
+	1289: {region: 0x164, script: 0x52, flags: 0x0},
+	1290: {region: 0x164, script: 0x52, flags: 0x0},
+	1291: {region: 0x164, script: 0x52, flags: 0x0},
+	1292: {region: 0x164, script: 0x52, flags: 0x0},
+	1293: {region: 0x164, script: 0x52, flags: 0x0},
+	1294: {region: 0xd5, script: 0x52, flags: 0x0},
+	1295: {region: 0x164, script: 0x52, flags: 0x0},
+	1296: {region: 0x164, script: 0x52, flags: 0x0},
+	1297: {region: 0x164, script: 0x52, flags: 0x0},
+	1298: {region: 0x40, script: 0x52, flags: 0x0},
+	1299: {region: 0x164, script: 0x52, flags: 0x0},
+	1300: {region: 0xce, script: 0x52, flags: 0x0},
+	1301: {region: 0x4c, script: 0x3, flags: 0x1},
+	1302: {region: 0x164, script: 0x52, flags: 0x0},
+	1303: {region: 0x164, script: 0x52, flags: 0x0},
+	1304: {region: 0x164, script: 0x52, flags: 0x0},
+	1305: {region: 0x52, script: 0x52, flags: 0x0},
+	1306: {region: 0x10a, script: 0x52, flags: 0x0},
+	1308: {region: 0xa7, script: 0x5, flags: 0x0},
+	1309: {region: 0xd8, script: 0x52, flags: 0x0},
+	1310: {region: 0xb9, script: 0xd2, flags: 0x0},
+	1311: {region: 0x4f, script: 0x14, flags: 0x1},
+	1312: {region: 0x164, script: 0x52, flags: 0x0},
+	1313: {region: 0x121, script: 0x52, flags: 0x0},
+	1314: {region: 0xcf, script: 0x52, flags: 0x0},
+	1315: {region: 0x164, script: 0x52, flags: 0x0},
+	1316: {region: 0x160, script: 0x52, flags: 0x0},
+	1318: {region: 0x12a, script: 0x52, flags: 0x0},
+}
+
+// likelyLangList holds lists info associated with likelyLang.
+// Size: 396 bytes, 99 elements
+var likelyLangList = [99]likelyScriptRegion{
+	0:  {region: 0x9b, script: 0x7, flags: 0x0},
+	1:  {region: 0xa0, script: 0x6d, flags: 0x2},
+	2:  {region: 0x11b, script: 0x78, flags: 0x2},
+	3:  {region: 0x31, script: 0x52, flags: 0x0},
+	4:  {region: 0x9a, script: 0x5, flags: 0x4},
+	5:  {region: 0x9b, script: 0x5, flags: 0x4},
+	6:  {region: 0x105, script: 0x1e, flags: 0x4},
+	7:  {region: 0x9b, script: 0x5, flags: 0x2},
+	8:  {region: 0x98, script: 0xe, flags: 0x0},
+	9:  {region: 0x34, script: 0x16, flags: 0x2},
+	10: {region: 0x105, script: 0x1e, flags: 0x0},
+	11: {region: 0x37, script: 0x2a, flags: 0x2},
+	12: {region: 0x134, script: 0x52, flags: 0x0},
+	13: {region: 0x7a, script: 0xbd, flags: 0x2},
+	14: {region: 0x113, script: 0x52, flags: 0x0},
+	15: {region: 0x83, script: 0x1, flags: 0x2},
+	16: {region: 0x5c, script: 0x1d, flags: 0x0},
+	17: {region: 0x86, script: 0x57, flags: 0x2},
+	18: {region: 0xd5, script: 0x52, flags: 0x0},
+	19: {region: 0x51, script: 0x5, flags: 0x4},
+	20: {region: 0x10a, script: 0x5, flags: 0x4},
+	21: {region: 0xad, script: 0x1e, flags: 0x0},
+	22: {region: 0x23, script: 0x5, flags: 0x4},
+	23: {region: 0x52, script: 0x5, flags: 0x4},
+	24: {region: 0x9b, script: 0x5, flags: 0x4},
+	25: {region: 0xc4, script: 0x5, flags: 0x4},
+	26: {region: 0x52, script: 0x5, flags: 0x2},
+	27: {region: 0x12a, script: 0x52, flags: 0x0},
+	28: {region: 0xaf, script: 0x5, flags: 0x4},
+	29: {region: 0x9a, script: 0x5, flags: 0x2},
+	30: {region: 0xa4, script: 0x1e, flags: 0x0},
+	31: {region: 0x52, script: 0x5, flags: 0x4},
+	32: {region: 0x12a, script: 0x52, flags: 0x4},
+	33: {region: 0x52, script: 0x5, flags: 0x2},
+	34: {region: 0x12a, script: 0x52, flags: 0x2},
+	35: {region: 0xda, script: 0x20, flags: 0x0},
+	36: {region: 0x98, script: 0x55, flags: 0x2},
+	37: {region: 0x82, script: 0x52, flags: 0x0},
+	38: {region: 0x83, script: 0x70, flags: 0x4},
+	39: {region: 0x83, script: 0x70, flags: 0x2},
+	40: {region: 0xc4, script: 0x1e, flags: 0x0},
+	41: {region: 0x52, script: 0x66, flags: 0x4},
+	42: {region: 0x52, script: 0x66, flags: 0x2},
+	43: {region: 0xcf, script: 0x52, flags: 0x0},
+	44: {region: 0x49, script: 0x5, flags: 0x4},
+	45: {region: 0x94, script: 0x5, flags: 0x4},
+	46: {region: 0x98, script: 0x2f, flags: 0x0},
+	47: {region: 0xe7, script: 0x5, flags: 0x4},
+	48: {region: 0xe7, script: 0x5, flags: 0x2},
+	49: {region: 0x9b, script: 0x7c, flags: 0x0},
+	50: {region: 0x52, script: 0x7d, flags: 0x2},
+	51: {region: 0xb9, script: 0xd2, flags: 0x0},
+	52: {region: 0xd8, script: 0x52, flags: 0x4},
+	53: {region: 0xe7, script: 0x5, flags: 0x0},
+	54: {region: 0x98, script: 0x20, flags: 0x2},
+	55: {region: 0x98, script: 0x47, flags: 0x2},
+	56: {region: 0x98, script: 0xc0, flags: 0x2},
+	57: {region: 0x104, script: 0x1e, flags: 0x0},
+	58: {region: 0xbc, script: 0x52, flags: 0x4},
+	59: {region: 0x103, script: 0x52, flags: 0x4},
+	60: {region: 0x105, script: 0x52, flags: 0x4},
+	61: {region: 0x12a, script: 0x52, flags: 0x4},
+	62: {region: 0x123, script: 0x1e, flags: 0x0},
+	63: {region: 0xe7, script: 0x5, flags: 0x4},
+	64: {region: 0xe7, script: 0x5, flags: 0x2},
+	65: {region: 0x52, script: 0x5, flags: 0x0},
+	66: {region: 0xad, script: 0x1e, flags: 0x4},
+	67: {region: 0xc4, script: 0x1e, flags: 0x4},
+	68: {region: 0xad, script: 0x1e, flags: 0x2},
+	69: {region: 0x98, script: 0xe, flags: 0x0},
+	70: {region: 0xda, script: 0x20, flags: 0x4},
+	71: {region: 0xda, script: 0x20, flags: 0x2},
+	72: {region: 0x136, script: 0x52, flags: 0x0},
+	73: {region: 0x23, script: 0x5, flags: 0x4},
+	74: {region: 0x52, script: 0x1e, flags: 0x4},
+	75: {region: 0x23, script: 0x5, flags: 0x2},
+	76: {region: 0x8c, script: 0x35, flags: 0x0},
+	77: {region: 0x52, script: 0x34, flags: 0x4},
+	78: {region: 0x52, script: 0x34, flags: 0x2},
+	79: {region: 0x52, script: 0x34, flags: 0x0},
+	80: {region: 0x2e, script: 0x35, flags: 0x4},
+	81: {region: 0x3d, script: 0x35, flags: 0x4},
+	82: {region: 0x7a, script: 0x35, flags: 0x4},
+	83: {region: 0x7d, script: 0x35, flags: 0x4},
+	84: {region: 0x8c, script: 0x35, flags: 0x4},
+	85: {region: 0x94, script: 0x35, flags: 0x4},
+	86: {region: 0xc5, script: 0x35, flags: 0x4},
+	87: {region: 0xcf, script: 0x35, flags: 0x4},
+	88: {region: 0xe1, script: 0x35, flags: 0x4},
+	89: {region: 0xe4, script: 0x35, flags: 0x4},
+	90: {region: 0xe6, script: 0x35, flags: 0x4},
+	91: {region: 0x115, script: 0x35, flags: 0x4},
+	92: {region: 0x122, script: 0x35, flags: 0x4},
+	93: {region: 0x12d, script: 0x35, flags: 0x4},
+	94: {region: 0x134, script: 0x35, flags: 0x4},
+	95: {region: 0x13d, script: 0x35, flags: 0x4},
+	96: {region: 0x12d, script: 0x11, flags: 0x2},
+	97: {region: 0x12d, script: 0x30, flags: 0x2},
+	98: {region: 0x12d, script: 0x35, flags: 0x2},
+}
+
+type likelyLangScript struct {
+	lang   uint16
+	script uint8
+	flags  uint8
+}
+
+// likelyRegion is a lookup table, indexed by regionID, for the most likely
+// languages and scripts given incomplete information. If more entries exist
+// for a given regionID, lang and script are the index and size respectively
+// of the list in likelyRegionList.
+// TODO: exclude containers and user-definable regions from the list.
+// Size: 1428 bytes, 357 elements
+var likelyRegion = [357]likelyLangScript{
+	33:  {lang: 0xd5, script: 0x52, flags: 0x0},
+	34:  {lang: 0x39, script: 0x5, flags: 0x0},
+	35:  {lang: 0x0, script: 0x2, flags: 0x1},
+	38:  {lang: 0x2, script: 0x2, flags: 0x1},
+	39:  {lang: 0x4, script: 0x2, flags: 0x1},
+	41:  {lang: 0x3b7, script: 0x52, flags: 0x0},
+	42:  {lang: 0x0, script: 0x52, flags: 0x0},
+	43:  {lang: 0x139, script: 0x52, flags: 0x0},
+	44:  {lang: 0x411, script: 0x52, flags: 0x0},
+	45:  {lang: 0x109, script: 0x52, flags: 0x0},
+	47:  {lang: 0x35e, script: 0x52, flags: 0x0},
+	48:  {lang: 0x43a, script: 0x52, flags: 0x0},
+	49:  {lang: 0x57, script: 0x52, flags: 0x0},
+	50:  {lang: 0x6, script: 0x2, flags: 0x1},
+	52:  {lang: 0xa3, script: 0xe, flags: 0x0},
+	53:  {lang: 0x35e, script: 0x52, flags: 0x0},
+	54:  {lang: 0x159, script: 0x52, flags: 0x0},
+	55:  {lang: 0x7d, script: 0x1e, flags: 0x0},
+	56:  {lang: 0x39, script: 0x5, flags: 0x0},
+	57:  {lang: 0x3d0, script: 0x52, flags: 0x0},
+	58:  {lang: 0x159, script: 0x52, flags: 0x0},
+	59:  {lang: 0x159, script: 0x52, flags: 0x0},
+	61:  {lang: 0x316, script: 0x52, flags: 0x0},
+	62:  {lang: 0x139, script: 0x52, flags: 0x0},
+	63:  {lang: 0x398, script: 0x52, flags: 0x0},
+	64:  {lang: 0x3b7, script: 0x52, flags: 0x0},
+	66:  {lang: 0x8, script: 0x2, flags: 0x1},
+	68:  {lang: 0x0, script: 0x52, flags: 0x0},
+	70:  {lang: 0x70, script: 0x1e, flags: 0x0},
+	72:  {lang: 0x508, script: 0x37, flags: 0x2},
+	73:  {lang: 0x316, script: 0x5, flags: 0x2},
+	74:  {lang: 0x43b, script: 0x52, flags: 0x0},
+	75:  {lang: 0x159, script: 0x52, flags: 0x0},
+	76:  {lang: 0x159, script: 0x52, flags: 0x0},
+	77:  {lang: 0x109, script: 0x52, flags: 0x0},
+	78:  {lang: 0x159, script: 0x52, flags: 0x0},
+	80:  {lang: 0x139, script: 0x52, flags: 0x0},
+	81:  {lang: 0x159, script: 0x52, flags: 0x0},
+	82:  {lang: 0xa, script: 0x5, flags: 0x1},
+	83:  {lang: 0x139, script: 0x52, flags: 0x0},
+	84:  {lang: 0x0, script: 0x52, flags: 0x0},
+	85:  {lang: 0x139, script: 0x52, flags: 0x0},
+	88:  {lang: 0x139, script: 0x52, flags: 0x0},
+	89:  {lang: 0x3b7, script: 0x52, flags: 0x0},
+	90:  {lang: 0x398, script: 0x52, flags: 0x0},
+	92:  {lang: 0xf, script: 0x2, flags: 0x1},
+	93:  {lang: 0xf6, script: 0x52, flags: 0x0},
+	95:  {lang: 0x109, script: 0x52, flags: 0x0},
+	97:  {lang: 0x1, script: 0x52, flags: 0x0},
+	98:  {lang: 0xfd, script: 0x52, flags: 0x0},
+	100: {lang: 0x139, script: 0x52, flags: 0x0},
+	102: {lang: 0x11, script: 0x2, flags: 0x1},
+	103: {lang: 0x139, script: 0x52, flags: 0x0},
+	104: {lang: 0x139, script: 0x52, flags: 0x0},
+	105: {lang: 0x13b, script: 0x52, flags: 0x0},
+	106: {lang: 0x39, script: 0x5, flags: 0x0},
+	107: {lang: 0x39, script: 0x5, flags: 0x0},
+	108: {lang: 0x465, script: 0x27, flags: 0x0},
+	109: {lang: 0x139, script: 0x52, flags: 0x0},
+	110: {lang: 0x13, script: 0x2, flags: 0x1},
+	112: {lang: 0x109, script: 0x52, flags: 0x0},
+	113: {lang: 0x14c, script: 0x52, flags: 0x0},
+	114: {lang: 0x1b9, script: 0x20, flags: 0x2},
+	117: {lang: 0x153, script: 0x52, flags: 0x0},
+	119: {lang: 0x159, script: 0x52, flags: 0x0},
+	121: {lang: 0x159, script: 0x52, flags: 0x0},
+	122: {lang: 0x15, script: 0x2, flags: 0x1},
+	124: {lang: 0x17, script: 0x3, flags: 0x1},
+	125: {lang: 0x159, script: 0x52, flags: 0x0},
+	127: {lang: 0x20, script: 0x52, flags: 0x0},
+	129: {lang: 0x23d, script: 0x52, flags: 0x0},
+	131: {lang: 0x159, script: 0x52, flags: 0x0},
+	132: {lang: 0x159, script: 0x52, flags: 0x0},
+	133: {lang: 0x139, script: 0x52, flags: 0x0},
+	134: {lang: 0x1a, script: 0x2, flags: 0x1},
+	135: {lang: 0x0, script: 0x52, flags: 0x0},
+	136: {lang: 0x139, script: 0x52, flags: 0x0},
+	138: {lang: 0x3b7, script: 0x52, flags: 0x0},
+	140: {lang: 0x51f, script: 0x35, flags: 0x0},
+	141: {lang: 0x0, script: 0x52, flags: 0x0},
+	142: {lang: 0x139, script: 0x52, flags: 0x0},
+	143: {lang: 0x1ca, script: 0x52, flags: 0x0},
+	144: {lang: 0x1cd, script: 0x52, flags: 0x0},
+	145: {lang: 0x1ce, script: 0x52, flags: 0x0},
+	147: {lang: 0x139, script: 0x52, flags: 0x0},
+	148: {lang: 0x1c, script: 0x2, flags: 0x1},
+	150: {lang: 0x1b5, script: 0x37, flags: 0x0},
+	152: {lang: 0x1e, script: 0x3, flags: 0x1},
+	154: {lang: 0x39, script: 0x5, flags: 0x0},
+	155: {lang: 0x21, script: 0x2, flags: 0x1},
+	156: {lang: 0x1f0, script: 0x52, flags: 0x0},
+	157: {lang: 0x1f1, script: 0x52, flags: 0x0},
+	160: {lang: 0x39, script: 0x5, flags: 0x0},
+	161: {lang: 0x1f8, script: 0x41, flags: 0x0},
+	163: {lang: 0x43b, script: 0x52, flags: 0x0},
+	164: {lang: 0x281, script: 0x1e, flags: 0x0},
+	165: {lang: 0x23, script: 0x3, flags: 0x1},
+	167: {lang: 0x26, script: 0x2, flags: 0x1},
+	169: {lang: 0x24b, script: 0x4b, flags: 0x0},
+	170: {lang: 0x24b, script: 0x4b, flags: 0x0},
+	171: {lang: 0x39, script: 0x5, flags: 0x0},
+	173: {lang: 0x3d9, script: 0x1e, flags: 0x0},
+	174: {lang: 0x28, script: 0x2, flags: 0x1},
+	175: {lang: 0x39, script: 0x5, flags: 0x0},
+	177: {lang: 0x109, script: 0x52, flags: 0x0},
+	178: {lang: 0x402, script: 0xc1, flags: 0x0},
+	180: {lang: 0x431, script: 0x52, flags: 0x0},
+	181: {lang: 0x2b7, script: 0x52, flags: 0x0},
+	182: {lang: 0x159, script: 0x52, flags: 0x0},
+	183: {lang: 0x2be, script: 0x52, flags: 0x0},
+	184: {lang: 0x39, script: 0x5, flags: 0x0},
+	185: {lang: 0x2a, script: 0x2, flags: 0x1},
+	186: {lang: 0x159, script: 0x52, flags: 0x0},
+	187: {lang: 0x2c, script: 0x2, flags: 0x1},
+	188: {lang: 0x428, script: 0x52, flags: 0x0},
+	189: {lang: 0x159, script: 0x52, flags: 0x0},
+	190: {lang: 0x2e8, script: 0x52, flags: 0x0},
+	193: {lang: 0x2e, script: 0x2, flags: 0x1},
+	194: {lang: 0x9e, script: 0x52, flags: 0x0},
+	195: {lang: 0x30, script: 0x2, flags: 0x1},
+	196: {lang: 0x32, script: 0x2, flags: 0x1},
+	197: {lang: 0x34, script: 0x2, flags: 0x1},
+	199: {lang: 0x159, script: 0x52, flags: 0x0},
+	200: {lang: 0x36, script: 0x2, flags: 0x1},
+	202: {lang: 0x317, script: 0x52, flags: 0x0},
+	203: {lang: 0x38, script: 0x3, flags: 0x1},
+	204: {lang: 0x124, script: 0xd4, flags: 0x0},
+	206: {lang: 0x139, script: 0x52, flags: 0x0},
+	207: {lang: 0x316, script: 0x52, flags: 0x0},
+	208: {lang: 0x3b7, script: 0x52, flags: 0x0},
+	209: {lang: 0x15, script: 0x52, flags: 0x0},
+	210: {lang: 0x159, script: 0x52, flags: 0x0},
+	211: {lang: 0x1ad, script: 0x52, flags: 0x0},
+	213: {lang: 0x1ad, script: 0x5, flags: 0x2},
+	215: {lang: 0x139, script: 0x52, flags: 0x0},
+	216: {lang: 0x35e, script: 0x52, flags: 0x0},
+	217: {lang: 0x33e, script: 0x52, flags: 0x0},
+	218: {lang: 0x348, script: 0x20, flags: 0x0},
+	224: {lang: 0x39, script: 0x5, flags: 0x0},
+	225: {lang: 0x139, script: 0x52, flags: 0x0},
+	227: {lang: 0x139, script: 0x52, flags: 0x0},
+	228: {lang: 0x159, script: 0x52, flags: 0x0},
+	229: {lang: 0x47c, script: 0x52, flags: 0x0},
+	230: {lang: 0x14e, script: 0x52, flags: 0x0},
+	231: {lang: 0x3b, script: 0x3, flags: 0x1},
+	232: {lang: 0x3e, script: 0x2, flags: 0x1},
+	233: {lang: 0x159, script: 0x52, flags: 0x0},
+	235: {lang: 0x139, script: 0x52, flags: 0x0},
+	236: {lang: 0x39, script: 0x5, flags: 0x0},
+	237: {lang: 0x3b7, script: 0x52, flags: 0x0},
+	239: {lang: 0x399, script: 0x52, flags: 0x0},
+	240: {lang: 0x18e, script: 0x52, flags: 0x0},
+	242: {lang: 0x39, script: 0x5, flags: 0x0},
+	257: {lang: 0x159, script: 0x52, flags: 0x0},
+	259: {lang: 0x40, script: 0x2, flags: 0x1},
+	260: {lang: 0x428, script: 0x1e, flags: 0x0},
+	261: {lang: 0x42, script: 0x2, flags: 0x1},
+	262: {lang: 0x3dc, script: 0x52, flags: 0x0},
+	263: {lang: 0x39, script: 0x5, flags: 0x0},
+	265: {lang: 0x159, script: 0x52, flags: 0x0},
+	266: {lang: 0x39, script: 0x5, flags: 0x0},
+	267: {lang: 0x44, script: 0x2, flags: 0x1},
+	270: {lang: 0x40c, script: 0x52, flags: 0x0},
+	271: {lang: 0x33e, script: 0x52, flags: 0x0},
+	272: {lang: 0x46, script: 0x2, flags: 0x1},
+	274: {lang: 0x1f1, script: 0x52, flags: 0x0},
+	275: {lang: 0x159, script: 0x52, flags: 0x0},
+	276: {lang: 0x41f, script: 0x52, flags: 0x0},
+	277: {lang: 0x35e, script: 0x52, flags: 0x0},
+	279: {lang: 0x3b7, script: 0x52, flags: 0x0},
+	281: {lang: 0x139, script: 0x52, flags: 0x0},
+	283: {lang: 0x48, script: 0x2, flags: 0x1},
+	287: {lang: 0x159, script: 0x52, flags: 0x0},
+	288: {lang: 0x159, script: 0x52, flags: 0x0},
+	289: {lang: 0x4a, script: 0x2, flags: 0x1},
+	290: {lang: 0x4c, script: 0x3, flags: 0x1},
+	291: {lang: 0x4f, script: 0x2, flags: 0x1},
+	292: {lang: 0x46d, script: 0x52, flags: 0x0},
+	293: {lang: 0x3b7, script: 0x52, flags: 0x0},
+	294: {lang: 0x46c, script: 0x52, flags: 0x0},
+	295: {lang: 0x51, script: 0x2, flags: 0x1},
+	296: {lang: 0x478, script: 0x52, flags: 0x0},
+	298: {lang: 0x53, script: 0x4, flags: 0x1},
+	300: {lang: 0x496, script: 0x52, flags: 0x0},
+	301: {lang: 0x57, script: 0x2, flags: 0x1},
+	302: {lang: 0x43b, script: 0x52, flags: 0x0},
+	303: {lang: 0x59, script: 0x3, flags: 0x1},
+	304: {lang: 0x43b, script: 0x52, flags: 0x0},
+	308: {lang: 0x508, script: 0x37, flags: 0x2},
+	309: {lang: 0x139, script: 0x52, flags: 0x0},
+	310: {lang: 0x4b2, script: 0x52, flags: 0x0},
+	311: {lang: 0x1f1, script: 0x52, flags: 0x0},
+	314: {lang: 0x139, script: 0x52, flags: 0x0},
+	317: {lang: 0x4b9, script: 0x52, flags: 0x0},
+	318: {lang: 0x89, script: 0x52, flags: 0x0},
+	319: {lang: 0x159, script: 0x52, flags: 0x0},
+	321: {lang: 0x411, script: 0x52, flags: 0x0},
+	332: {lang: 0x5c, script: 0x2, flags: 0x1},
+	349: {lang: 0x39, script: 0x5, flags: 0x0},
+	350: {lang: 0x5e, script: 0x2, flags: 0x1},
+	355: {lang: 0x419, script: 0x52, flags: 0x0},
+}
+
+// likelyRegionList holds lists info associated with likelyRegion.
+// Size: 384 bytes, 96 elements
+var likelyRegionList = [96]likelyLangScript{
+	0:  {lang: 0x143, script: 0x5, flags: 0x0},
+	1:  {lang: 0x46c, script: 0x52, flags: 0x0},
+	2:  {lang: 0x427, script: 0x52, flags: 0x0},
+	3:  {lang: 0x2f6, script: 0x1e, flags: 0x0},
+	4:  {lang: 0x1d0, script: 0x8, flags: 0x0},
+	5:  {lang: 0x26b, script: 0x52, flags: 0x0},
+	6:  {lang: 0xb5, script: 0x52, flags: 0x0},
+	7:  {lang: 0x428, script: 0x1e, flags: 0x0},
+	8:  {lang: 0x129, script: 0xd6, flags: 0x0},
+	9:  {lang: 0x348, script: 0x20, flags: 0x0},
+	10: {lang: 0x51f, script: 0x34, flags: 0x0},
+	11: {lang: 0x4a2, script: 0x5, flags: 0x0},
+	12: {lang: 0x515, script: 0x35, flags: 0x0},
+	13: {lang: 0x519, script: 0x52, flags: 0x0},
+	14: {lang: 0x291, script: 0xd5, flags: 0x0},
+	15: {lang: 0x131, script: 0x2d, flags: 0x0},
+	16: {lang: 0x480, script: 0x52, flags: 0x0},
+	17: {lang: 0x39, script: 0x5, flags: 0x0},
+	18: {lang: 0x159, script: 0x52, flags: 0x0},
+	19: {lang: 0x26, script: 0x27, flags: 0x0},
+	20: {lang: 0x134, script: 0x52, flags: 0x0},
+	21: {lang: 0x261, script: 0x5, flags: 0x2},
+	22: {lang: 0x508, script: 0x37, flags: 0x2},
+	23: {lang: 0x208, script: 0x29, flags: 0x0},
+	24: {lang: 0x5, script: 0x1e, flags: 0x0},
+	25: {lang: 0x26b, script: 0x52, flags: 0x0},
+	26: {lang: 0x131, script: 0x2d, flags: 0x0},
+	27: {lang: 0x2f6, script: 0x1e, flags: 0x0},
+	28: {lang: 0x1da, script: 0x52, flags: 0x0},
+	29: {lang: 0x316, script: 0x5, flags: 0x0},
+	30: {lang: 0x1b7, script: 0x20, flags: 0x0},
+	31: {lang: 0x4aa, script: 0x5, flags: 0x0},
+	32: {lang: 0x22e, script: 0x6b, flags: 0x0},
+	33: {lang: 0x143, script: 0x5, flags: 0x0},
+	34: {lang: 0x46c, script: 0x52, flags: 0x0},
+	35: {lang: 0x242, script: 0x46, flags: 0x0},
+	36: {lang: 0xe4, script: 0x5, flags: 0x0},
+	37: {lang: 0x21e, script: 0xd5, flags: 0x0},
+	38: {lang: 0x39, script: 0x5, flags: 0x0},
+	39: {lang: 0x159, script: 0x52, flags: 0x0},
+	40: {lang: 0x2af, script: 0x4f, flags: 0x0},
+	41: {lang: 0x21e, script: 0xd5, flags: 0x0},
+	42: {lang: 0x39, script: 0x5, flags: 0x0},
+	43: {lang: 0x159, script: 0x52, flags: 0x0},
+	44: {lang: 0x3d3, script: 0x52, flags: 0x0},
+	45: {lang: 0x4a4, script: 0x1e, flags: 0x0},
+	46: {lang: 0x2f6, script: 0x1e, flags: 0x0},
+	47: {lang: 0x427, script: 0x52, flags: 0x0},
+	48: {lang: 0x328, script: 0x6b, flags: 0x0},
+	49: {lang: 0x20b, script: 0x52, flags: 0x0},
+	50: {lang: 0x302, script: 0x1e, flags: 0x0},
+	51: {lang: 0x23a, script: 0x5, flags: 0x0},
+	52: {lang: 0x51f, script: 0x35, flags: 0x0},
+	53: {lang: 0x3b7, script: 0x52, flags: 0x0},
+	54: {lang: 0x39, script: 0x5, flags: 0x0},
+	55: {lang: 0x159, script: 0x52, flags: 0x0},
+	56: {lang: 0x2e4, script: 0x52, flags: 0x0},
+	57: {lang: 0x4aa, script: 0x5, flags: 0x0},
+	58: {lang: 0x87, script: 0x20, flags: 0x0},
+	59: {lang: 0x4aa, script: 0x5, flags: 0x0},
+	60: {lang: 0x4aa, script: 0x5, flags: 0x0},
+	61: {lang: 0xbc, script: 0x20, flags: 0x0},
+	62: {lang: 0x3aa, script: 0x52, flags: 0x0},
+	63: {lang: 0x70, script: 0x1e, flags: 0x0},
+	64: {lang: 0x3d3, script: 0x52, flags: 0x0},
+	65: {lang: 0x7d, script: 0x1e, flags: 0x0},
+	66: {lang: 0x3d9, script: 0x1e, flags: 0x0},
+	67: {lang: 0x25e, script: 0x52, flags: 0x0},
+	68: {lang: 0x43a, script: 0x52, flags: 0x0},
+	69: {lang: 0x508, script: 0x37, flags: 0x0},
+	70: {lang: 0x408, script: 0x52, flags: 0x0},
+	71: {lang: 0x4a4, script: 0x1e, flags: 0x0},
+	72: {lang: 0x39, script: 0x5, flags: 0x0},
+	73: {lang: 0x159, script: 0x52, flags: 0x0},
+	74: {lang: 0x159, script: 0x52, flags: 0x0},
+	75: {lang: 0x34, script: 0x5, flags: 0x0},
+	76: {lang: 0x461, script: 0xd5, flags: 0x0},
+	77: {lang: 0x2e3, script: 0x5, flags: 0x0},
+	78: {lang: 0x306, script: 0x6b, flags: 0x0},
+	79: {lang: 0x45d, script: 0x1e, flags: 0x0},
+	80: {lang: 0x143, script: 0x5, flags: 0x0},
+	81: {lang: 0x39, script: 0x5, flags: 0x0},
+	82: {lang: 0x159, script: 0x52, flags: 0x0},
+	83: {lang: 0x480, script: 0x52, flags: 0x0},
+	84: {lang: 0x57, script: 0x5, flags: 0x0},
+	85: {lang: 0x211, script: 0x1e, flags: 0x0},
+	86: {lang: 0x80, script: 0x2d, flags: 0x0},
+	87: {lang: 0x51f, script: 0x35, flags: 0x0},
+	88: {lang: 0x482, script: 0x52, flags: 0x0},
+	89: {lang: 0x4a4, script: 0x1e, flags: 0x0},
+	90: {lang: 0x508, script: 0x37, flags: 0x0},
+	91: {lang: 0x3aa, script: 0x52, flags: 0x0},
+	92: {lang: 0x427, script: 0x52, flags: 0x0},
+	93: {lang: 0x428, script: 0x1e, flags: 0x0},
+	94: {lang: 0x159, script: 0x52, flags: 0x0},
+	95: {lang: 0x43c, script: 0x5, flags: 0x0},
+}
+
+type likelyTag struct {
+	lang   uint16
+	region uint16
+	script uint8
+}
+
+// Size: 192 bytes, 32 elements
+var likelyRegionGroup = [32]likelyTag{
+	1:  {lang: 0x134, region: 0xd5, script: 0x52},
+	2:  {lang: 0x134, region: 0x134, script: 0x52},
+	3:  {lang: 0x3b7, region: 0x40, script: 0x52},
+	4:  {lang: 0x134, region: 0x2e, script: 0x52},
+	5:  {lang: 0x134, region: 0xd5, script: 0x52},
+	6:  {lang: 0x139, region: 0xce, script: 0x52},
+	7:  {lang: 0x43b, region: 0x12e, script: 0x52},
+	8:  {lang: 0x39, region: 0x6a, script: 0x5},
+	9:  {lang: 0x43b, region: 0x4a, script: 0x52},
+	10: {lang: 0x134, region: 0x160, script: 0x52},
+	11: {lang: 0x134, region: 0x134, script: 0x52},
+	12: {lang: 0x134, region: 0x134, script: 0x52},
+	13: {lang: 0x139, region: 0x58, script: 0x52},
+	14: {lang: 0x51f, region: 0x52, script: 0x34},
+	15: {lang: 0x1b7, region: 0x98, script: 0x20},
+	16: {lang: 0x1da, region: 0x94, script: 0x52},
+	17: {lang: 0x1f1, region: 0x9d, script: 0x52},
+	18: {lang: 0x134, region: 0x2e, script: 0x52},
+	19: {lang: 0x134, region: 0xe5, script: 0x52},
+	20: {lang: 0x134, region: 0x89, script: 0x52},
+	21: {lang: 0x411, region: 0x141, script: 0x52},
+	22: {lang: 0x51f, region: 0x52, script: 0x34},
+	23: {lang: 0x4b2, region: 0x136, script: 0x52},
+	24: {lang: 0x39, region: 0x107, script: 0x5},
+	25: {lang: 0x3d9, region: 0x105, script: 0x1e},
+	26: {lang: 0x3d9, region: 0x105, script: 0x1e},
+	27: {lang: 0x134, region: 0x7a, script: 0x52},
+	28: {lang: 0x109, region: 0x5f, script: 0x52},
+	29: {lang: 0x139, region: 0x1e, script: 0x52},
+	30: {lang: 0x134, region: 0x99, script: 0x52},
+	31: {lang: 0x134, region: 0x7a, script: 0x52},
+}
+
+type mutualIntelligibility struct {
+	want   uint16
+	have   uint16
+	conf   uint8
+	oneway bool
+}
+
+type scriptIntelligibility struct {
+	lang uint16
+	want uint8
+	have uint8
+	conf uint8
+}
+
+// matchLang holds pairs of langIDs of base languages that are typically
+// mutually intelligible. Each pair is associated with a confidence and
+// whether the intelligibility goes one or both ways.
+// Size: 708 bytes, 118 elements
+var matchLang = [118]mutualIntelligibility{
+	0:   {want: 0x366, have: 0x33e, conf: 0x2, oneway: false},
+	1:   {want: 0x26b, have: 0xe7, conf: 0x2, oneway: false},
+	2:   {want: 0x1ca, have: 0xb5, conf: 0x2, oneway: false},
+	3:   {want: 0x3fd, have: 0xb5, conf: 0x2, oneway: false},
+	4:   {want: 0x428, have: 0xb5, conf: 0x2, oneway: false},
+	5:   {want: 0x3fd, have: 0x1ca, conf: 0x2, oneway: false},
+	6:   {want: 0x428, have: 0x1ca, conf: 0x2, oneway: false},
+	7:   {want: 0x3fd, have: 0x428, conf: 0x2, oneway: false},
+	8:   {want: 0x430, have: 0x1, conf: 0x2, oneway: false},
+	9:   {want: 0x19c, have: 0x109, conf: 0x2, oneway: true},
+	10:  {want: 0x28c, have: 0x109, conf: 0x2, oneway: true},
+	11:  {want: 0xfd, have: 0x366, conf: 0x2, oneway: false},
+	12:  {want: 0xfd, have: 0x33e, conf: 0x2, oneway: false},
+	13:  {want: 0xe7, have: 0x26b, conf: 0x2, oneway: false},
+	14:  {want: 0x5, have: 0x3d9, conf: 0x2, oneway: true},
+	15:  {want: 0xc, have: 0x134, conf: 0x2, oneway: true},
+	16:  {want: 0x15, have: 0x35e, conf: 0x2, oneway: true},
+	17:  {want: 0x20, have: 0x134, conf: 0x2, oneway: true},
+	18:  {want: 0x55, have: 0x139, conf: 0x2, oneway: true},
+	19:  {want: 0x57, have: 0x3d9, conf: 0x2, oneway: true},
+	20:  {want: 0x70, have: 0x3d9, conf: 0x2, oneway: true},
+	21:  {want: 0x74, have: 0x134, conf: 0x2, oneway: true},
+	22:  {want: 0x81, have: 0x1b7, conf: 0x2, oneway: true},
+	23:  {want: 0xa3, have: 0x134, conf: 0x2, oneway: true},
+	24:  {want: 0xb0, have: 0x159, conf: 0x2, oneway: true},
+	25:  {want: 0xdb, have: 0x14e, conf: 0x2, oneway: true},
+	26:  {want: 0xe3, have: 0x134, conf: 0x2, oneway: true},
+	27:  {want: 0xe7, have: 0x39, conf: 0x2, oneway: true},
+	28:  {want: 0xed, have: 0x159, conf: 0x2, oneway: true},
+	29:  {want: 0xf5, have: 0x159, conf: 0x2, oneway: true},
+	30:  {want: 0xfc, have: 0x134, conf: 0x2, oneway: true},
+	31:  {want: 0x12c, have: 0x134, conf: 0x2, oneway: true},
+	32:  {want: 0x137, have: 0x134, conf: 0x2, oneway: true},
+	33:  {want: 0x13b, have: 0x14c, conf: 0x2, oneway: true},
+	34:  {want: 0x140, have: 0x139, conf: 0x2, oneway: true},
+	35:  {want: 0x153, have: 0xfd, conf: 0x2, oneway: true},
+	36:  {want: 0x168, have: 0x35e, conf: 0x2, oneway: true},
+	37:  {want: 0x169, have: 0x134, conf: 0x2, oneway: true},
+	38:  {want: 0x16a, have: 0x134, conf: 0x2, oneway: true},
+	39:  {want: 0x178, have: 0x134, conf: 0x2, oneway: true},
+	40:  {want: 0x18a, have: 0x139, conf: 0x2, oneway: true},
+	41:  {want: 0x18e, have: 0x139, conf: 0x2, oneway: true},
+	42:  {want: 0x19d, have: 0x1b7, conf: 0x2, oneway: true},
+	43:  {want: 0x1ad, have: 0x134, conf: 0x2, oneway: true},
+	44:  {want: 0x1b1, have: 0x134, conf: 0x2, oneway: true},
+	45:  {want: 0x1cd, have: 0x159, conf: 0x2, oneway: true},
+	46:  {want: 0x1d0, have: 0x3d9, conf: 0x2, oneway: true},
+	47:  {want: 0x1d2, have: 0x134, conf: 0x2, oneway: true},
+	48:  {want: 0x1df, have: 0x134, conf: 0x2, oneway: true},
+	49:  {want: 0x1f0, have: 0x134, conf: 0x2, oneway: true},
+	50:  {want: 0x206, have: 0x1da, conf: 0x2, oneway: true},
+	51:  {want: 0x208, have: 0x134, conf: 0x2, oneway: true},
+	52:  {want: 0x225, have: 0x159, conf: 0x2, oneway: true},
+	53:  {want: 0x23a, have: 0x3d9, conf: 0x2, oneway: true},
+	54:  {want: 0x242, have: 0x134, conf: 0x2, oneway: true},
+	55:  {want: 0x249, have: 0x134, conf: 0x2, oneway: true},
+	56:  {want: 0x25c, have: 0x134, conf: 0x2, oneway: true},
+	57:  {want: 0x26b, have: 0x480, conf: 0x2, oneway: true},
+	58:  {want: 0x281, have: 0x3d9, conf: 0x2, oneway: true},
+	59:  {want: 0x285, have: 0x1f1, conf: 0x2, oneway: true},
+	60:  {want: 0x29a, have: 0x134, conf: 0x2, oneway: true},
+	61:  {want: 0x2ac, have: 0x159, conf: 0x2, oneway: true},
+	62:  {want: 0x2af, have: 0x134, conf: 0x2, oneway: true},
+	63:  {want: 0x2b5, have: 0x134, conf: 0x2, oneway: true},
+	64:  {want: 0x2ba, have: 0x159, conf: 0x2, oneway: true},
+	65:  {want: 0x2e4, have: 0x134, conf: 0x2, oneway: true},
+	66:  {want: 0x2e8, have: 0x159, conf: 0x2, oneway: true},
+	67:  {want: 0x2f1, have: 0x134, conf: 0x2, oneway: true},
+	68:  {want: 0x2f6, have: 0x7d, conf: 0x2, oneway: true},
+	69:  {want: 0x2fb, have: 0x134, conf: 0x2, oneway: true},
+	70:  {want: 0x302, have: 0x3d9, conf: 0x2, oneway: true},
+	71:  {want: 0x312, have: 0x1b7, conf: 0x2, oneway: true},
+	72:  {want: 0x316, have: 0x1da, conf: 0x2, oneway: true},
+	73:  {want: 0x317, have: 0x134, conf: 0x2, oneway: true},
+	74:  {want: 0x328, have: 0x134, conf: 0x2, oneway: true},
+	75:  {want: 0x348, have: 0x134, conf: 0x2, oneway: true},
+	76:  {want: 0x361, have: 0x33e, conf: 0x2, oneway: false},
+	77:  {want: 0x361, have: 0x366, conf: 0x2, oneway: true},
+	78:  {want: 0x371, have: 0x134, conf: 0x2, oneway: true},
+	79:  {want: 0x37e, have: 0x134, conf: 0x2, oneway: true},
+	80:  {want: 0x380, have: 0x134, conf: 0x2, oneway: true},
+	81:  {want: 0x382, have: 0x159, conf: 0x2, oneway: true},
+	82:  {want: 0x387, have: 0x134, conf: 0x2, oneway: true},
+	83:  {want: 0x38c, have: 0x134, conf: 0x2, oneway: true},
+	84:  {want: 0x394, have: 0x134, conf: 0x2, oneway: true},
+	85:  {want: 0x39c, have: 0x134, conf: 0x2, oneway: true},
+	86:  {want: 0x3b5, have: 0x134, conf: 0x2, oneway: true},
+	87:  {want: 0x3bb, have: 0x139, conf: 0x2, oneway: true},
+	88:  {want: 0x3cb, have: 0x109, conf: 0x2, oneway: true},
+	89:  {want: 0x3d0, have: 0x134, conf: 0x2, oneway: true},
+	90:  {want: 0x3dc, have: 0x159, conf: 0x2, oneway: true},
+	91:  {want: 0x3e0, have: 0x1b7, conf: 0x2, oneway: true},
+	92:  {want: 0x3f0, have: 0x134, conf: 0x2, oneway: true},
+	93:  {want: 0x402, have: 0x134, conf: 0x2, oneway: true},
+	94:  {want: 0x419, have: 0x134, conf: 0x2, oneway: true},
+	95:  {want: 0x41f, have: 0x134, conf: 0x2, oneway: true},
+	96:  {want: 0x427, have: 0x134, conf: 0x2, oneway: true},
+	97:  {want: 0x431, have: 0x134, conf: 0x2, oneway: true},
+	98:  {want: 0x434, have: 0x1da, conf: 0x2, oneway: true},
+	99:  {want: 0x43b, have: 0x134, conf: 0x2, oneway: true},
+	100: {want: 0x446, have: 0x134, conf: 0x2, oneway: true},
+	101: {want: 0x457, have: 0x134, conf: 0x2, oneway: true},
+	102: {want: 0x45d, have: 0x3d9, conf: 0x2, oneway: true},
+	103: {want: 0x465, have: 0x134, conf: 0x2, oneway: true},
+	104: {want: 0x46c, have: 0x3d9, conf: 0x2, oneway: true},
+	105: {want: 0x3878, have: 0x134, conf: 0x2, oneway: true},
+	106: {want: 0x476, have: 0x134, conf: 0x2, oneway: true},
+	107: {want: 0x478, have: 0x134, conf: 0x2, oneway: true},
+	108: {want: 0x48a, have: 0x3d9, conf: 0x2, oneway: true},
+	109: {want: 0x493, have: 0x134, conf: 0x2, oneway: true},
+	110: {want: 0x4a2, have: 0x51f, conf: 0x2, oneway: true},
+	111: {want: 0x4aa, have: 0x134, conf: 0x2, oneway: true},
+	112: {want: 0x4b2, have: 0x3d9, conf: 0x2, oneway: true},
+	113: {want: 0x4db, have: 0x159, conf: 0x2, oneway: true},
+	114: {want: 0x4e8, have: 0x134, conf: 0x2, oneway: true},
+	115: {want: 0x508, have: 0x134, conf: 0x2, oneway: true},
+	116: {want: 0x50e, have: 0x134, conf: 0x2, oneway: true},
+	117: {want: 0x524, have: 0x134, conf: 0x2, oneway: true},
+}
+
+// matchScript holds pairs of scriptIDs where readers of one script
+// can typically also read the other. Each is associated with a confidence.
+// Size: 24 bytes, 4 elements
+var matchScript = [4]scriptIntelligibility{
+	0: {lang: 0x428, want: 0x52, have: 0x1e, conf: 0x2},
+	1: {lang: 0x428, want: 0x1e, have: 0x52, conf: 0x2},
+	2: {lang: 0x0, want: 0x34, have: 0x35, conf: 0x1},
+	3: {lang: 0x0, want: 0x35, have: 0x34, conf: 0x1},
+}
+
+// Size: 128 bytes, 32 elements
+var regionContainment = [32]uint32{
+	0xffffffff, 0x000007a2, 0x00003044, 0x00000008,
+	0x403c0010, 0x00000020, 0x00000040, 0x00000080,
+	0x00000100, 0x00000200, 0x00000400, 0x2000384c,
+	0x00001000, 0x00002000, 0x00004000, 0x00008000,
+	0x00010000, 0x00020000, 0x00040000, 0x00080000,
+	0x00100000, 0x00200000, 0x01c1c000, 0x00800000,
+	0x01000000, 0x1e020000, 0x04000000, 0x08000000,
+	0x10000000, 0x20002048, 0x40000000, 0x80000000,
+}
+
+// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
+// where each set holds all groupings that are directly connected in a region
+// containment graph.
+// Size: 357 bytes, 357 elements
+var regionInclusion = [357]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
+	0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
+	0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
+	0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x20,
+	0x21, 0x22, 0x23, 0x24, 0x25, 0x25, 0x22, 0x23,
+	0x25, 0x26, 0x21, 0x27, 0x28, 0x29, 0x2a, 0x25,
+	0x2b, 0x23, 0x22, 0x25, 0x24, 0x29, 0x2c, 0x2d,
+	0x23, 0x2e, 0x2c, 0x25, 0x2f, 0x30, 0x27, 0x25,
+	// Entry 40 - 7F
+	0x27, 0x25, 0x24, 0x30, 0x21, 0x31, 0x32, 0x33,
+	0x2f, 0x21, 0x26, 0x26, 0x26, 0x34, 0x2c, 0x28,
+	0x27, 0x26, 0x35, 0x27, 0x21, 0x33, 0x22, 0x20,
+	0x25, 0x2c, 0x25, 0x21, 0x36, 0x2d, 0x34, 0x29,
+	0x21, 0x2e, 0x37, 0x25, 0x25, 0x20, 0x38, 0x38,
+	0x27, 0x37, 0x38, 0x38, 0x2e, 0x39, 0x2e, 0x1f,
+	0x20, 0x37, 0x3a, 0x27, 0x3b, 0x2b, 0x20, 0x29,
+	0x34, 0x26, 0x37, 0x25, 0x23, 0x27, 0x2b, 0x2c,
+	// Entry 80 - BF
+	0x22, 0x2f, 0x2c, 0x2c, 0x25, 0x26, 0x39, 0x21,
+	0x33, 0x3b, 0x2c, 0x27, 0x35, 0x21, 0x33, 0x39,
+	0x25, 0x2d, 0x20, 0x38, 0x30, 0x37, 0x23, 0x2b,
+	0x24, 0x21, 0x23, 0x24, 0x2b, 0x39, 0x2b, 0x25,
+	0x23, 0x35, 0x20, 0x2e, 0x3c, 0x30, 0x3b, 0x2e,
+	0x25, 0x35, 0x35, 0x23, 0x25, 0x3c, 0x30, 0x23,
+	0x25, 0x34, 0x24, 0x2c, 0x31, 0x37, 0x29, 0x37,
+	0x38, 0x38, 0x34, 0x32, 0x22, 0x25, 0x2e, 0x3b,
+	// Entry C0 - FF
+	0x20, 0x22, 0x2c, 0x30, 0x35, 0x35, 0x3b, 0x25,
+	0x2c, 0x25, 0x39, 0x2e, 0x24, 0x2e, 0x33, 0x30,
+	0x2e, 0x31, 0x3a, 0x2c, 0x2a, 0x2c, 0x20, 0x33,
+	0x29, 0x2b, 0x24, 0x20, 0x3b, 0x23, 0x28, 0x2a,
+	0x23, 0x33, 0x20, 0x27, 0x28, 0x3a, 0x30, 0x24,
+	0x2d, 0x2f, 0x28, 0x25, 0x23, 0x39, 0x20, 0x3b,
+	0x27, 0x20, 0x23, 0x20, 0x20, 0x1e, 0x20, 0x20,
+	0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20,
+	// Entry 100 - 13F
+	0x20, 0x2e, 0x20, 0x2d, 0x22, 0x32, 0x2e, 0x23,
+	0x3a, 0x2e, 0x38, 0x37, 0x30, 0x2c, 0x39, 0x2b,
+	0x2d, 0x2c, 0x22, 0x2c, 0x2e, 0x27, 0x2e, 0x26,
+	0x32, 0x33, 0x25, 0x23, 0x31, 0x21, 0x25, 0x26,
+	0x21, 0x2c, 0x30, 0x3c, 0x28, 0x30, 0x3c, 0x38,
+	0x28, 0x30, 0x23, 0x25, 0x28, 0x35, 0x2e, 0x32,
+	0x2e, 0x20, 0x21, 0x20, 0x2f, 0x27, 0x3c, 0x22,
+	0x25, 0x20, 0x27, 0x25, 0x25, 0x30, 0x3a, 0x28,
+	// Entry 140 - 17F
+	0x20, 0x28, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20,
+	0x20, 0x20, 0x20, 0x20, 0x22, 0x20, 0x20, 0x20,
+	0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20,
+	0x20, 0x20, 0x20, 0x20, 0x23, 0x23, 0x2e, 0x22,
+	0x31, 0x2e, 0x26, 0x2e, 0x20,
+}
+
+// regionInclusionBits is an array of bit vectors where every vector represents
+// a set of region groupings.  These sets are used to compute the distance
+// between two regions for the purpose of language matching.
+// Size: 288 bytes, 72 elements
+var regionInclusionBits = [72]uint32{
+	// Entry 0 - 1F
+	0x82400813, 0x000007a3, 0x00003844, 0x20000808,
+	0x403c0011, 0x00000022, 0x20000844, 0x00000082,
+	0x00000102, 0x00000202, 0x00000402, 0x2000384d,
+	0x00001804, 0x20002804, 0x00404000, 0x00408000,
+	0x00410000, 0x02020000, 0x00040010, 0x00080010,
+	0x00100010, 0x00200010, 0x01c1c001, 0x00c00000,
+	0x01400000, 0x1e020001, 0x06000000, 0x0a000000,
+	0x12000000, 0x20002848, 0x40000010, 0x80000001,
+	// Entry 20 - 3F
+	0x00000001, 0x40000000, 0x00020000, 0x01000000,
+	0x00008000, 0x00002000, 0x00000200, 0x00000008,
+	0x00200000, 0x90000000, 0x00040000, 0x08000000,
+	0x00000020, 0x84000000, 0x00000080, 0x00001000,
+	0x00010000, 0x00000400, 0x04000000, 0x00000040,
+	0x10000000, 0x00004000, 0x81000000, 0x88000000,
+	0x00000100, 0x80020000, 0x00080000, 0x00100000,
+	0x00800000, 0xffffffff, 0x82400fb3, 0xc27c0813,
+	// Entry 40 - 5F
+	0xa240385f, 0x83c1c813, 0x9e420813, 0x92000001,
+	0x86000001, 0x81400001, 0x8a000001, 0x82020001,
+}
+
+// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
+// all groups that are reachable from the groups set in the respective entry.
+// Size: 72 bytes, 72 elements
+var regionInclusionNext = [72]uint8{
+	// Entry 0 - 3F
+	0x3d, 0x3e, 0x0b, 0x0b, 0x3f, 0x01, 0x0b, 0x01,
+	0x01, 0x01, 0x01, 0x40, 0x0b, 0x0b, 0x16, 0x16,
+	0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x41, 0x16,
+	0x16, 0x42, 0x19, 0x19, 0x19, 0x0b, 0x04, 0x00,
+	0x00, 0x1e, 0x11, 0x18, 0x0f, 0x0d, 0x09, 0x03,
+	0x15, 0x43, 0x12, 0x1b, 0x05, 0x44, 0x07, 0x0c,
+	0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x45, 0x46,
+	0x08, 0x47, 0x13, 0x14, 0x17, 0x3d, 0x3d, 0x3d,
+	// Entry 40 - 7F
+	0x3d, 0x3d, 0x3d, 0x42, 0x42, 0x41, 0x42, 0x42,
+}
+
+type parentRel struct {
+	lang       uint16
+	script     uint8
+	maxScript  uint8
+	toRegion   uint16
+	fromRegion []uint16
+}
+
+// Size: 412 bytes, 5 elements
+var parents = [5]parentRel{
+	0: {lang: 0x134, script: 0x0, maxScript: 0x52, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x24, 0x25, 0x2e, 0x33, 0x35, 0x3c, 0x41, 0x45, 0x47, 0x48, 0x49, 0x4f, 0x51, 0x5b, 0x5c, 0x60, 0x63, 0x6c, 0x72, 0x73, 0x74, 0x7a, 0x7b, 0x7e, 0x7f, 0x80, 0x82, 0x8b, 0x8c, 0x95, 0x96, 0x97, 0x98, 0x99, 0x9e, 0x9f, 0xa3, 0xa6, 0xa8, 0xac, 0xb0, 0xb3, 0xb4, 0xbe, 0xc5, 0xc9, 0xca, 0xcb, 0xcd, 0xcf, 0xd1, 0xd4, 0xd5, 0xdc, 0xde, 0xdf, 0xe5, 0xe6, 0xe7, 0xea, 0xef, 0x106, 0x108, 0x109, 0x10a, 0x10c, 0x10d, 0x111, 0x116, 0x11a, 0x11c, 0x11e, 0x124, 0x128, 0x12b, 0x12c, 0x12e, 0x130, 0x138, 0x13b, 0x13e, 0x141, 0x160, 0x161, 0x163}},
+	1: {lang: 0x134, script: 0x0, maxScript: 0x52, toRegion: 0x1a, fromRegion: []uint16{0x2d, 0x4d, 0x5f, 0x62, 0x71, 0xd8, 0x10b, 0x10e}},
+	2: {lang: 0x139, script: 0x0, maxScript: 0x52, toRegion: 0x1e, fromRegion: []uint16{0x2b, 0x3e, 0x40, 0x50, 0x53, 0x55, 0x58, 0x64, 0x68, 0x88, 0x8e, 0xce, 0xd7, 0xe1, 0xe3, 0xeb, 0xf0, 0x119, 0x134, 0x135, 0x13a}},
+	3: {lang: 0x3b7, script: 0x0, maxScript: 0x52, toRegion: 0xed, fromRegion: []uint16{0x29, 0x4d, 0x59, 0x85, 0x8a, 0xb6, 0xc5, 0xd0, 0x117, 0x125}},
+	4: {lang: 0x51f, script: 0x35, maxScript: 0x35, toRegion: 0x8c, fromRegion: []uint16{0xc5}},
+}
+
+// Total table size 25825 bytes (25KiB); checksum: 4E97CC5E
diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go
new file mode 100644
index 000000000..de30155a2
--- /dev/null
+++ b/vendor/golang.org/x/text/language/tags.go
@@ -0,0 +1,143 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// TODO: Various sets of commonly use tags and regions.
+
+// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
+// It simplifies safe initialization of Tag values.
+func MustParse(s string) Tag {
+	t, err := Parse(s)
+	if err != nil {
+		panic(err)
+	}
+	return t
+}
+
+// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
+// It simplifies safe initialization of Tag values.
+func (c CanonType) MustParse(s string) Tag {
+	t, err := c.Parse(s)
+	if err != nil {
+		panic(err)
+	}
+	return t
+}
+
+// MustParseBase is like ParseBase, but panics if the given base cannot be parsed.
+// It simplifies safe initialization of Base values.
+func MustParseBase(s string) Base {
+	b, err := ParseBase(s)
+	if err != nil {
+		panic(err)
+	}
+	return b
+}
+
+// MustParseScript is like ParseScript, but panics if the given script cannot be
+// parsed. It simplifies safe initialization of Script values.
+func MustParseScript(s string) Script {
+	scr, err := ParseScript(s)
+	if err != nil {
+		panic(err)
+	}
+	return scr
+}
+
+// MustParseRegion is like ParseRegion, but panics if the given region cannot be
+// parsed. It simplifies safe initialization of Region values.
+func MustParseRegion(s string) Region {
+	r, err := ParseRegion(s)
+	if err != nil {
+		panic(err)
+	}
+	return r
+}
+
+var (
+	und = Tag{}
+
+	Und Tag = Tag{}
+
+	Afrikaans            Tag = Tag{lang: _af}                //  af
+	Amharic              Tag = Tag{lang: _am}                //  am
+	Arabic               Tag = Tag{lang: _ar}                //  ar
+	ModernStandardArabic Tag = Tag{lang: _ar, region: _001}  //  ar-001
+	Azerbaijani          Tag = Tag{lang: _az}                //  az
+	Bulgarian            Tag = Tag{lang: _bg}                //  bg
+	Bengali              Tag = Tag{lang: _bn}                //  bn
+	Catalan              Tag = Tag{lang: _ca}                //  ca
+	Czech                Tag = Tag{lang: _cs}                //  cs
+	Danish               Tag = Tag{lang: _da}                //  da
+	German               Tag = Tag{lang: _de}                //  de
+	Greek                Tag = Tag{lang: _el}                //  el
+	English              Tag = Tag{lang: _en}                //  en
+	AmericanEnglish      Tag = Tag{lang: _en, region: _US}   //  en-US
+	BritishEnglish       Tag = Tag{lang: _en, region: _GB}   //  en-GB
+	Spanish              Tag = Tag{lang: _es}                //  es
+	EuropeanSpanish      Tag = Tag{lang: _es, region: _ES}   //  es-ES
+	LatinAmericanSpanish Tag = Tag{lang: _es, region: _419}  //  es-419
+	Estonian             Tag = Tag{lang: _et}                //  et
+	Persian              Tag = Tag{lang: _fa}                //  fa
+	Finnish              Tag = Tag{lang: _fi}                //  fi
+	Filipino             Tag = Tag{lang: _fil}               //  fil
+	French               Tag = Tag{lang: _fr}                //  fr
+	CanadianFrench       Tag = Tag{lang: _fr, region: _CA}   //  fr-CA
+	Gujarati             Tag = Tag{lang: _gu}                //  gu
+	Hebrew               Tag = Tag{lang: _he}                //  he
+	Hindi                Tag = Tag{lang: _hi}                //  hi
+	Croatian             Tag = Tag{lang: _hr}                //  hr
+	Hungarian            Tag = Tag{lang: _hu}                //  hu
+	Armenian             Tag = Tag{lang: _hy}                //  hy
+	Indonesian           Tag = Tag{lang: _id}                //  id
+	Icelandic            Tag = Tag{lang: _is}                //  is
+	Italian              Tag = Tag{lang: _it}                //  it
+	Japanese             Tag = Tag{lang: _ja}                //  ja
+	Georgian             Tag = Tag{lang: _ka}                //  ka
+	Kazakh               Tag = Tag{lang: _kk}                //  kk
+	Khmer                Tag = Tag{lang: _km}                //  km
+	Kannada              Tag = Tag{lang: _kn}                //  kn
+	Korean               Tag = Tag{lang: _ko}                //  ko
+	Kirghiz              Tag = Tag{lang: _ky}                //  ky
+	Lao                  Tag = Tag{lang: _lo}                //  lo
+	Lithuanian           Tag = Tag{lang: _lt}                //  lt
+	Latvian              Tag = Tag{lang: _lv}                //  lv
+	Macedonian           Tag = Tag{lang: _mk}                //  mk
+	Malayalam            Tag = Tag{lang: _ml}                //  ml
+	Mongolian            Tag = Tag{lang: _mn}                //  mn
+	Marathi              Tag = Tag{lang: _mr}                //  mr
+	Malay                Tag = Tag{lang: _ms}                //  ms
+	Burmese              Tag = Tag{lang: _my}                //  my
+	Nepali               Tag = Tag{lang: _ne}                //  ne
+	Dutch                Tag = Tag{lang: _nl}                //  nl
+	Norwegian            Tag = Tag{lang: _no}                //  no
+	Punjabi              Tag = Tag{lang: _pa}                //  pa
+	Polish               Tag = Tag{lang: _pl}                //  pl
+	Portuguese           Tag = Tag{lang: _pt}                //  pt
+	BrazilianPortuguese  Tag = Tag{lang: _pt, region: _BR}   //  pt-BR
+	EuropeanPortuguese   Tag = Tag{lang: _pt, region: _PT}   //  pt-PT
+	Romanian             Tag = Tag{lang: _ro}                //  ro
+	Russian              Tag = Tag{lang: _ru}                //  ru
+	Sinhala              Tag = Tag{lang: _si}                //  si
+	Slovak               Tag = Tag{lang: _sk}                //  sk
+	Slovenian            Tag = Tag{lang: _sl}                //  sl
+	Albanian             Tag = Tag{lang: _sq}                //  sq
+	Serbian              Tag = Tag{lang: _sr}                //  sr
+	SerbianLatin         Tag = Tag{lang: _sr, script: _Latn} //  sr-Latn
+	Swedish              Tag = Tag{lang: _sv}                //  sv
+	Swahili              Tag = Tag{lang: _sw}                //  sw
+	Tamil                Tag = Tag{lang: _ta}                //  ta
+	Telugu               Tag = Tag{lang: _te}                //  te
+	Thai                 Tag = Tag{lang: _th}                //  th
+	Turkish              Tag = Tag{lang: _tr}                //  tr
+	Ukrainian            Tag = Tag{lang: _uk}                //  uk
+	Urdu                 Tag = Tag{lang: _ur}                //  ur
+	Uzbek                Tag = Tag{lang: _uz}                //  uz
+	Vietnamese           Tag = Tag{lang: _vi}                //  vi
+	Chinese              Tag = Tag{lang: _zh}                //  zh
+	SimplifiedChinese    Tag = Tag{lang: _zh, script: _Hans} //  zh-Hans
+	TraditionalChinese   Tag = Tag{lang: _zh, script: _Hant} //  zh-Hant
+	Zulu                 Tag = Tag{lang: _zu}                //  zu
+)