vendor: update everything

* If possible, update each dependency to the latest available version.

* Use releases over commit IDs and avoid vendoring branches.

Signed-off-by: Valentin Rothberg <rothberg@redhat.com>

10 files changed, 1032 insertions, 6477 deletions

diff --git a/vendor/golang.org/x/text/language/common.go b/vendor/golang.org/x/text/language/common.go
deleted file mode 100644
index a255bb0a5..000000000
--- a/vendor/golang.org/x/text/language/common.go
+++ /dev/null
@@ -1,16 +0,0 @@
-// This file was generated by go generate; DO NOT EDIT
-
-package language
-
-// This file contains code common to the maketables.go and the package code.
-
-// langAliasType is the type of an alias in langAliasMap.
-type langAliasType int8
-
-const (
-	langDeprecated langAliasType = iota
-	langMacro
-	langLegacy
-
-	langAliasTypeUnknown langAliasType = -1
-)
diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go
index 101fd23c1..a24fd1a4d 100644
--- a/vendor/golang.org/x/text/language/coverage.go
+++ b/vendor/golang.org/x/text/language/coverage.go
@@ -7,6 +7,8 @@ package language
 import (
 	"fmt"
 	"sort"
+
+	"golang.org/x/text/internal/language"
 )
 
 // The Coverage interface is used to define the level of coverage of an
@@ -44,9 +46,9 @@ type allSubtags struct{}
 // consecutive range, it simply returns a slice of numbers in increasing order.
 // The "undefined" region is not returned.
 func (s allSubtags) Regions() []Region {
-	reg := make([]Region, numRegions)
+	reg := make([]Region, language.NumRegions)
 	for i := range reg {
-		reg[i] = Region{regionID(i + 1)}
+		reg[i] = Region{language.Region(i + 1)}
 	}
 	return reg
 }
@@ -55,9 +57,9 @@ func (s allSubtags) Regions() []Region {
 // consecutive range, it simply returns a slice of numbers in increasing order.
 // The "undefined" script is not returned.
 func (s allSubtags) Scripts() []Script {
-	scr := make([]Script, numScripts)
+	scr := make([]Script, language.NumScripts)
 	for i := range scr {
-		scr[i] = Script{scriptID(i + 1)}
+		scr[i] = Script{language.Script(i + 1)}
 	}
 	return scr
 }
@@ -65,22 +67,10 @@ func (s allSubtags) Scripts() []Script {
 // BaseLanguages returns the list of all supported base languages. It generates
 // the list by traversing the internal structures.
 func (s allSubtags) BaseLanguages() []Base {
-	base := make([]Base, 0, numLanguages)
-	for i := 0; i < langNoIndexOffset; i++ {
-		// We included "und" already for the value 0.
-		if i != nonCanonicalUnd {
-			base = append(base, Base{langID(i)})
-		}
-	}
-	i := langNoIndexOffset
-	for _, v := range langNoIndex {
-		for k := 0; k < 8; k++ {
-			if v&1 == 1 {
-				base = append(base, Base{langID(i)})
-			}
-			v >>= 1
-			i++
-		}
+	bs := language.BaseLanguages()
+	base := make([]Base, len(bs))
+	for i, b := range bs {
+		base[i] = Base{b}
 	}
 	return base
 }
@@ -90,7 +80,7 @@ func (s allSubtags) Tags() []Tag {
 	return nil
 }
 
-// coverage is used used by NewCoverage which is used as a convenient way for
+// coverage is used by NewCoverage which is used as a convenient way for
 // creating Coverage implementations for partially defined data. Very often a
 // package will only need to define a subset of slices. coverage provides a
 // convenient way to do this. Moreover, packages using NewCoverage, instead of
@@ -134,7 +124,7 @@ func (s *coverage) BaseLanguages() []Base {
 		}
 		a := make([]Base, len(tags))
 		for i, t := range tags {
-			a[i] = Base{langID(t.lang)}
+			a[i] = Base{language.Language(t.lang())}
 		}
 		sort.Sort(bases(a))
 		k := 0
diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go
new file mode 100644
index 000000000..8afecd50e
--- /dev/null
+++ b/vendor/golang.org/x/text/language/doc.go
@@ -0,0 +1,102 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package language implements BCP 47 language tags and related functionality.
+//
+// The most important function of package language is to match a list of
+// user-preferred languages to a list of supported languages.
+// It alleviates the developer of dealing with the complexity of this process
+// and provides the user with the best experience
+// (see https://blog.golang.org/matchlang).
+//
+//
+// Matching preferred against supported languages
+//
+// A Matcher for an application that supports English, Australian English,
+// Danish, and standard Mandarin can be created as follows:
+//
+//    var matcher = language.NewMatcher([]language.Tag{
+//        language.English,   // The first language is used as fallback.
+//        language.MustParse("en-AU"),
+//        language.Danish,
+//        language.Chinese,
+//    })
+//
+// This list of supported languages is typically implied by the languages for
+// which there exists translations of the user interface.
+//
+// User-preferred languages usually come as a comma-separated list of BCP 47
+// language tags.
+// The MatchString finds best matches for such strings:
+//
+//    handler(w http.ResponseWriter, r *http.Request) {
+//        lang, _ := r.Cookie("lang")
+//        accept := r.Header.Get("Accept-Language")
+//        tag, _ := language.MatchStrings(matcher, lang.String(), accept)
+//
+//        // tag should now be used for the initialization of any
+//        // locale-specific service.
+//    }
+//
+// The Matcher's Match method can be used to match Tags directly.
+//
+// Matchers are aware of the intricacies of equivalence between languages, such
+// as deprecated subtags, legacy tags, macro languages, mutual
+// intelligibility between scripts and languages, and transparently passing
+// BCP 47 user configuration.
+// For instance, it will know that a reader of Bokmål Danish can read Norwegian
+// and will know that Cantonese ("yue") is a good match for "zh-HK".
+//
+//
+// Using match results
+//
+// To guarantee a consistent user experience to the user it is important to
+// use the same language tag for the selection of any locale-specific services.
+// For example, it is utterly confusing to substitute spelled-out numbers
+// or dates in one language in text of another language.
+// More subtly confusing is using the wrong sorting order or casing
+// algorithm for a certain language.
+//
+//    All the packages in x/text that provide locale-specific services
+//    (e.g. collate, cases) should be initialized with the tag that was
+//    obtained at the start of an interaction with the user.
+//
+// Note that Tag that is returned by Match and MatchString may differ from any
+// of the supported languages, as it may contain carried over settings from
+// the user tags.
+// This may be inconvenient when your application has some additional
+// locale-specific data for your supported languages.
+// Match and MatchString both return the index of the matched supported tag
+// to simplify associating such data with the matched tag.
+//
+//
+// Canonicalization
+//
+// If one uses the Matcher to compare languages one does not need to
+// worry about canonicalization.
+//
+// The meaning of a Tag varies per application. The language package
+// therefore delays canonicalization and preserves information as much
+// as possible. The Matcher, however, will always take into account that
+// two different tags may represent the same language.
+//
+// By default, only legacy and deprecated tags are converted into their
+// canonical equivalent. All other information is preserved. This approach makes
+// the confidence scores more accurate and allows matchers to distinguish
+// between variants that are otherwise lost.
+//
+// As a consequence, two tags that should be treated as identical according to
+// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The
+// Matcher handles such distinctions, though, and is aware of the
+// equivalence relations. The CanonType type can be used to alter the
+// canonicalization form.
+//
+// References
+//
+// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47
+//
+package language // import "golang.org/x/text/language"
+
+// TODO: explanation on how to match languages for your own locale-specific
+// service.
diff --git a/vendor/golang.org/x/text/language/index.go b/vendor/golang.org/x/text/language/index.go
deleted file mode 100644
index 50c752186..000000000
--- a/vendor/golang.org/x/text/language/index.go
+++ /dev/null
@@ -1,767 +0,0 @@
-// This file was generated by go generate; DO NOT EDIT
-
-package language
-
-// NumCompactTags is the number of common tags. The maximum tag is
-// NumCompactTags-1.
-const NumCompactTags = 752
-
-var specialTags = []Tag{ // 2 elements
-	0: {lang: 0xd5, region: 0x6d, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"},
-	1: {lang: 0x134, region: 0x134, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"},
-} // Size: 72 bytes
-
-var coreTags = map[uint32]uint16{
-	0x0:        0,   // und
-	0x01500000: 3,   // af
-	0x015000d1: 4,   // af-NA
-	0x01500160: 5,   // af-ZA
-	0x01b00000: 6,   // agq
-	0x01b00051: 7,   // agq-CM
-	0x02000000: 8,   // ak
-	0x0200007f: 9,   // ak-GH
-	0x02600000: 10,  // am
-	0x0260006e: 11,  // am-ET
-	0x03900000: 12,  // ar
-	0x03900001: 13,  // ar-001
-	0x03900022: 14,  // ar-AE
-	0x03900038: 15,  // ar-BH
-	0x03900061: 16,  // ar-DJ
-	0x03900066: 17,  // ar-DZ
-	0x0390006a: 18,  // ar-EG
-	0x0390006b: 19,  // ar-EH
-	0x0390006c: 20,  // ar-ER
-	0x03900096: 21,  // ar-IL
-	0x0390009a: 22,  // ar-IQ
-	0x039000a0: 23,  // ar-JO
-	0x039000a7: 24,  // ar-KM
-	0x039000ab: 25,  // ar-KW
-	0x039000af: 26,  // ar-LB
-	0x039000b8: 27,  // ar-LY
-	0x039000b9: 28,  // ar-MA
-	0x039000c8: 29,  // ar-MR
-	0x039000e0: 30,  // ar-OM
-	0x039000ec: 31,  // ar-PS
-	0x039000f2: 32,  // ar-QA
-	0x03900107: 33,  // ar-SA
-	0x0390010a: 34,  // ar-SD
-	0x03900114: 35,  // ar-SO
-	0x03900116: 36,  // ar-SS
-	0x0390011b: 37,  // ar-SY
-	0x0390011f: 38,  // ar-TD
-	0x03900127: 39,  // ar-TN
-	0x0390015d: 40,  // ar-YE
-	0x03f00000: 41,  // ars
-	0x04200000: 42,  // as
-	0x04200098: 43,  // as-IN
-	0x04300000: 44,  // asa
-	0x0430012e: 45,  // asa-TZ
-	0x04700000: 46,  // ast
-	0x0470006d: 47,  // ast-ES
-	0x05700000: 48,  // az
-	0x0571e000: 49,  // az-Cyrl
-	0x0571e031: 50,  // az-Cyrl-AZ
-	0x05752000: 51,  // az-Latn
-	0x05752031: 52,  // az-Latn-AZ
-	0x05d00000: 53,  // bas
-	0x05d00051: 54,  // bas-CM
-	0x07000000: 55,  // be
-	0x07000046: 56,  // be-BY
-	0x07400000: 57,  // bem
-	0x07400161: 58,  // bem-ZM
-	0x07800000: 59,  // bez
-	0x0780012e: 60,  // bez-TZ
-	0x07d00000: 61,  // bg
-	0x07d00037: 62,  // bg-BG
-	0x08100000: 63,  // bh
-	0x09e00000: 64,  // bm
-	0x09e000c2: 65,  // bm-ML
-	0x0a300000: 66,  // bn
-	0x0a300034: 67,  // bn-BD
-	0x0a300098: 68,  // bn-IN
-	0x0a700000: 69,  // bo
-	0x0a700052: 70,  // bo-CN
-	0x0a700098: 71,  // bo-IN
-	0x0b000000: 72,  // br
-	0x0b000077: 73,  // br-FR
-	0x0b300000: 74,  // brx
-	0x0b300098: 75,  // brx-IN
-	0x0b500000: 76,  // bs
-	0x0b51e000: 77,  // bs-Cyrl
-	0x0b51e032: 78,  // bs-Cyrl-BA
-	0x0b552000: 79,  // bs-Latn
-	0x0b552032: 80,  // bs-Latn-BA
-	0x0d500000: 81,  // ca
-	0x0d500021: 82,  // ca-AD
-	0x0d50006d: 83,  // ca-ES
-	0x0d500077: 84,  // ca-FR
-	0x0d50009d: 85,  // ca-IT
-	0x0da00000: 86,  // ce
-	0x0da00105: 87,  // ce-RU
-	0x0dd00000: 88,  // cgg
-	0x0dd00130: 89,  // cgg-UG
-	0x0e300000: 90,  // chr
-	0x0e300134: 91,  // chr-US
-	0x0e700000: 92,  // ckb
-	0x0e70009a: 93,  // ckb-IQ
-	0x0e70009b: 94,  // ckb-IR
-	0x0f600000: 95,  // cs
-	0x0f60005d: 96,  // cs-CZ
-	0x0fa00000: 97,  // cu
-	0x0fa00105: 98,  // cu-RU
-	0x0fc00000: 99,  // cy
-	0x0fc0007a: 100, // cy-GB
-	0x0fd00000: 101, // da
-	0x0fd00062: 102, // da-DK
-	0x0fd00081: 103, // da-GL
-	0x10400000: 104, // dav
-	0x104000a3: 105, // dav-KE
-	0x10900000: 106, // de
-	0x1090002d: 107, // de-AT
-	0x10900035: 108, // de-BE
-	0x1090004d: 109, // de-CH
-	0x1090005f: 110, // de-DE
-	0x1090009d: 111, // de-IT
-	0x109000b1: 112, // de-LI
-	0x109000b6: 113, // de-LU
-	0x11300000: 114, // dje
-	0x113000d3: 115, // dje-NE
-	0x11b00000: 116, // dsb
-	0x11b0005f: 117, // dsb-DE
-	0x12000000: 118, // dua
-	0x12000051: 119, // dua-CM
-	0x12400000: 120, // dv
-	0x12700000: 121, // dyo
-	0x12700113: 122, // dyo-SN
-	0x12900000: 123, // dz
-	0x12900042: 124, // dz-BT
-	0x12b00000: 125, // ebu
-	0x12b000a3: 126, // ebu-KE
-	0x12c00000: 127, // ee
-	0x12c0007f: 128, // ee-GH
-	0x12c00121: 129, // ee-TG
-	0x13100000: 130, // el
-	0x1310005c: 131, // el-CY
-	0x13100086: 132, // el-GR
-	0x13400000: 133, // en
-	0x13400001: 134, // en-001
-	0x1340001a: 135, // en-150
-	0x13400024: 136, // en-AG
-	0x13400025: 137, // en-AI
-	0x1340002c: 138, // en-AS
-	0x1340002d: 139, // en-AT
-	0x1340002e: 140, // en-AU
-	0x13400033: 141, // en-BB
-	0x13400035: 142, // en-BE
-	0x13400039: 143, // en-BI
-	0x1340003c: 144, // en-BM
-	0x13400041: 145, // en-BS
-	0x13400045: 146, // en-BW
-	0x13400047: 147, // en-BZ
-	0x13400048: 148, // en-CA
-	0x13400049: 149, // en-CC
-	0x1340004d: 150, // en-CH
-	0x1340004f: 151, // en-CK
-	0x13400051: 152, // en-CM
-	0x1340005b: 153, // en-CX
-	0x1340005c: 154, // en-CY
-	0x1340005f: 155, // en-DE
-	0x13400060: 156, // en-DG
-	0x13400062: 157, // en-DK
-	0x13400063: 158, // en-DM
-	0x1340006c: 159, // en-ER
-	0x13400071: 160, // en-FI
-	0x13400072: 161, // en-FJ
-	0x13400073: 162, // en-FK
-	0x13400074: 163, // en-FM
-	0x1340007a: 164, // en-GB
-	0x1340007b: 165, // en-GD
-	0x1340007e: 166, // en-GG
-	0x1340007f: 167, // en-GH
-	0x13400080: 168, // en-GI
-	0x13400082: 169, // en-GM
-	0x13400089: 170, // en-GU
-	0x1340008b: 171, // en-GY
-	0x1340008c: 172, // en-HK
-	0x13400095: 173, // en-IE
-	0x13400096: 174, // en-IL
-	0x13400097: 175, // en-IM
-	0x13400098: 176, // en-IN
-	0x13400099: 177, // en-IO
-	0x1340009e: 178, // en-JE
-	0x1340009f: 179, // en-JM
-	0x134000a3: 180, // en-KE
-	0x134000a6: 181, // en-KI
-	0x134000a8: 182, // en-KN
-	0x134000ac: 183, // en-KY
-	0x134000b0: 184, // en-LC
-	0x134000b3: 185, // en-LR
-	0x134000b4: 186, // en-LS
-	0x134000be: 187, // en-MG
-	0x134000bf: 188, // en-MH
-	0x134000c5: 189, // en-MO
-	0x134000c6: 190, // en-MP
-	0x134000c9: 191, // en-MS
-	0x134000ca: 192, // en-MT
-	0x134000cb: 193, // en-MU
-	0x134000cd: 194, // en-MW
-	0x134000cf: 195, // en-MY
-	0x134000d1: 196, // en-NA
-	0x134000d4: 197, // en-NF
-	0x134000d5: 198, // en-NG
-	0x134000d8: 199, // en-NL
-	0x134000dc: 200, // en-NR
-	0x134000de: 201, // en-NU
-	0x134000df: 202, // en-NZ
-	0x134000e5: 203, // en-PG
-	0x134000e6: 204, // en-PH
-	0x134000e7: 205, // en-PK
-	0x134000ea: 206, // en-PN
-	0x134000eb: 207, // en-PR
-	0x134000ef: 208, // en-PW
-	0x13400106: 209, // en-RW
-	0x13400108: 210, // en-SB
-	0x13400109: 211, // en-SC
-	0x1340010a: 212, // en-SD
-	0x1340010b: 213, // en-SE
-	0x1340010c: 214, // en-SG
-	0x1340010d: 215, // en-SH
-	0x1340010e: 216, // en-SI
-	0x13400111: 217, // en-SL
-	0x13400116: 218, // en-SS
-	0x1340011a: 219, // en-SX
-	0x1340011c: 220, // en-SZ
-	0x1340011e: 221, // en-TC
-	0x13400124: 222, // en-TK
-	0x13400128: 223, // en-TO
-	0x1340012b: 224, // en-TT
-	0x1340012c: 225, // en-TV
-	0x1340012e: 226, // en-TZ
-	0x13400130: 227, // en-UG
-	0x13400132: 228, // en-UM
-	0x13400134: 229, // en-US
-	0x13400138: 230, // en-VC
-	0x1340013b: 231, // en-VG
-	0x1340013c: 232, // en-VI
-	0x1340013e: 233, // en-VU
-	0x13400141: 234, // en-WS
-	0x13400160: 235, // en-ZA
-	0x13400161: 236, // en-ZM
-	0x13400163: 237, // en-ZW
-	0x13700000: 238, // eo
-	0x13700001: 239, // eo-001
-	0x13900000: 240, // es
-	0x1390001e: 241, // es-419
-	0x1390002b: 242, // es-AR
-	0x1390003e: 243, // es-BO
-	0x13900040: 244, // es-BR
-	0x13900050: 245, // es-CL
-	0x13900053: 246, // es-CO
-	0x13900055: 247, // es-CR
-	0x13900058: 248, // es-CU
-	0x13900064: 249, // es-DO
-	0x13900067: 250, // es-EA
-	0x13900068: 251, // es-EC
-	0x1390006d: 252, // es-ES
-	0x13900085: 253, // es-GQ
-	0x13900088: 254, // es-GT
-	0x1390008e: 255, // es-HN
-	0x13900093: 256, // es-IC
-	0x139000ce: 257, // es-MX
-	0x139000d7: 258, // es-NI
-	0x139000e1: 259, // es-PA
-	0x139000e3: 260, // es-PE
-	0x139000e6: 261, // es-PH
-	0x139000eb: 262, // es-PR
-	0x139000f0: 263, // es-PY
-	0x13900119: 264, // es-SV
-	0x13900134: 265, // es-US
-	0x13900135: 266, // es-UY
-	0x1390013a: 267, // es-VE
-	0x13b00000: 268, // et
-	0x13b00069: 269, // et-EE
-	0x14000000: 270, // eu
-	0x1400006d: 271, // eu-ES
-	0x14100000: 272, // ewo
-	0x14100051: 273, // ewo-CM
-	0x14300000: 274, // fa
-	0x14300023: 275, // fa-AF
-	0x1430009b: 276, // fa-IR
-	0x14900000: 277, // ff
-	0x14900051: 278, // ff-CM
-	0x14900083: 279, // ff-GN
-	0x149000c8: 280, // ff-MR
-	0x14900113: 281, // ff-SN
-	0x14c00000: 282, // fi
-	0x14c00071: 283, // fi-FI
-	0x14e00000: 284, // fil
-	0x14e000e6: 285, // fil-PH
-	0x15300000: 286, // fo
-	0x15300062: 287, // fo-DK
-	0x15300075: 288, // fo-FO
-	0x15900000: 289, // fr
-	0x15900035: 290, // fr-BE
-	0x15900036: 291, // fr-BF
-	0x15900039: 292, // fr-BI
-	0x1590003a: 293, // fr-BJ
-	0x1590003b: 294, // fr-BL
-	0x15900048: 295, // fr-CA
-	0x1590004a: 296, // fr-CD
-	0x1590004b: 297, // fr-CF
-	0x1590004c: 298, // fr-CG
-	0x1590004d: 299, // fr-CH
-	0x1590004e: 300, // fr-CI
-	0x15900051: 301, // fr-CM
-	0x15900061: 302, // fr-DJ
-	0x15900066: 303, // fr-DZ
-	0x15900077: 304, // fr-FR
-	0x15900079: 305, // fr-GA
-	0x1590007d: 306, // fr-GF
-	0x15900083: 307, // fr-GN
-	0x15900084: 308, // fr-GP
-	0x15900085: 309, // fr-GQ
-	0x15900090: 310, // fr-HT
-	0x159000a7: 311, // fr-KM
-	0x159000b6: 312, // fr-LU
-	0x159000b9: 313, // fr-MA
-	0x159000ba: 314, // fr-MC
-	0x159000bd: 315, // fr-MF
-	0x159000be: 316, // fr-MG
-	0x159000c2: 317, // fr-ML
-	0x159000c7: 318, // fr-MQ
-	0x159000c8: 319, // fr-MR
-	0x159000cb: 320, // fr-MU
-	0x159000d2: 321, // fr-NC
-	0x159000d3: 322, // fr-NE
-	0x159000e4: 323, // fr-PF
-	0x159000e9: 324, // fr-PM
-	0x15900101: 325, // fr-RE
-	0x15900106: 326, // fr-RW
-	0x15900109: 327, // fr-SC
-	0x15900113: 328, // fr-SN
-	0x1590011b: 329, // fr-SY
-	0x1590011f: 330, // fr-TD
-	0x15900121: 331, // fr-TG
-	0x15900127: 332, // fr-TN
-	0x1590013e: 333, // fr-VU
-	0x1590013f: 334, // fr-WF
-	0x1590015e: 335, // fr-YT
-	0x16400000: 336, // fur
-	0x1640009d: 337, // fur-IT
-	0x16800000: 338, // fy
-	0x168000d8: 339, // fy-NL
-	0x16900000: 340, // ga
-	0x16900095: 341, // ga-IE
-	0x17800000: 342, // gd
-	0x1780007a: 343, // gd-GB
-	0x18a00000: 344, // gl
-	0x18a0006d: 345, // gl-ES
-	0x19c00000: 346, // gsw
-	0x19c0004d: 347, // gsw-CH
-	0x19c00077: 348, // gsw-FR
-	0x19c000b1: 349, // gsw-LI
-	0x19d00000: 350, // gu
-	0x19d00098: 351, // gu-IN
-	0x1a200000: 352, // guw
-	0x1a400000: 353, // guz
-	0x1a4000a3: 354, // guz-KE
-	0x1a500000: 355, // gv
-	0x1a500097: 356, // gv-IM
-	0x1ad00000: 357, // ha
-	0x1ad0007f: 358, // ha-GH
-	0x1ad000d3: 359, // ha-NE
-	0x1ad000d5: 360, // ha-NG
-	0x1b100000: 361, // haw
-	0x1b100134: 362, // haw-US
-	0x1b500000: 363, // he
-	0x1b500096: 364, // he-IL
-	0x1b700000: 365, // hi
-	0x1b700098: 366, // hi-IN
-	0x1ca00000: 367, // hr
-	0x1ca00032: 368, // hr-BA
-	0x1ca0008f: 369, // hr-HR
-	0x1cb00000: 370, // hsb
-	0x1cb0005f: 371, // hsb-DE
-	0x1ce00000: 372, // hu
-	0x1ce00091: 373, // hu-HU
-	0x1d000000: 374, // hy
-	0x1d000027: 375, // hy-AM
-	0x1da00000: 376, // id
-	0x1da00094: 377, // id-ID
-	0x1df00000: 378, // ig
-	0x1df000d5: 379, // ig-NG
-	0x1e200000: 380, // ii
-	0x1e200052: 381, // ii-CN
-	0x1f000000: 382, // is
-	0x1f00009c: 383, // is-IS
-	0x1f100000: 384, // it
-	0x1f10004d: 385, // it-CH
-	0x1f10009d: 386, // it-IT
-	0x1f100112: 387, // it-SM
-	0x1f200000: 388, // iu
-	0x1f800000: 389, // ja
-	0x1f8000a1: 390, // ja-JP
-	0x1fb00000: 391, // jbo
-	0x1ff00000: 392, // jgo
-	0x1ff00051: 393, // jgo-CM
-	0x20200000: 394, // jmc
-	0x2020012e: 395, // jmc-TZ
-	0x20600000: 396, // jv
-	0x20800000: 397, // ka
-	0x2080007c: 398, // ka-GE
-	0x20a00000: 399, // kab
-	0x20a00066: 400, // kab-DZ
-	0x20e00000: 401, // kaj
-	0x20f00000: 402, // kam
-	0x20f000a3: 403, // kam-KE
-	0x21700000: 404, // kcg
-	0x21b00000: 405, // kde
-	0x21b0012e: 406, // kde-TZ
-	0x21f00000: 407, // kea
-	0x21f00059: 408, // kea-CV
-	0x22c00000: 409, // khq
-	0x22c000c2: 410, // khq-ML
-	0x23100000: 411, // ki
-	0x231000a3: 412, // ki-KE
-	0x23a00000: 413, // kk
-	0x23a000ad: 414, // kk-KZ
-	0x23c00000: 415, // kkj
-	0x23c00051: 416, // kkj-CM
-	0x23d00000: 417, // kl
-	0x23d00081: 418, // kl-GL
-	0x23e00000: 419, // kln
-	0x23e000a3: 420, // kln-KE
-	0x24200000: 421, // km
-	0x242000a5: 422, // km-KH
-	0x24900000: 423, // kn
-	0x24900098: 424, // kn-IN
-	0x24b00000: 425, // ko
-	0x24b000a9: 426, // ko-KP
-	0x24b000aa: 427, // ko-KR
-	0x24d00000: 428, // kok
-	0x24d00098: 429, // kok-IN
-	0x26100000: 430, // ks
-	0x26100098: 431, // ks-IN
-	0x26200000: 432, // ksb
-	0x2620012e: 433, // ksb-TZ
-	0x26400000: 434, // ksf
-	0x26400051: 435, // ksf-CM
-	0x26500000: 436, // ksh
-	0x2650005f: 437, // ksh-DE
-	0x26b00000: 438, // ku
-	0x27800000: 439, // kw
-	0x2780007a: 440, // kw-GB
-	0x28100000: 441, // ky
-	0x281000a4: 442, // ky-KG
-	0x28800000: 443, // lag
-	0x2880012e: 444, // lag-TZ
-	0x28c00000: 445, // lb
-	0x28c000b6: 446, // lb-LU
-	0x29a00000: 447, // lg
-	0x29a00130: 448, // lg-UG
-	0x2a600000: 449, // lkt
-	0x2a600134: 450, // lkt-US
-	0x2ac00000: 451, // ln
-	0x2ac00029: 452, // ln-AO
-	0x2ac0004a: 453, // ln-CD
-	0x2ac0004b: 454, // ln-CF
-	0x2ac0004c: 455, // ln-CG
-	0x2af00000: 456, // lo
-	0x2af000ae: 457, // lo-LA
-	0x2b600000: 458, // lrc
-	0x2b60009a: 459, // lrc-IQ
-	0x2b60009b: 460, // lrc-IR
-	0x2b700000: 461, // lt
-	0x2b7000b5: 462, // lt-LT
-	0x2b900000: 463, // lu
-	0x2b90004a: 464, // lu-CD
-	0x2bb00000: 465, // luo
-	0x2bb000a3: 466, // luo-KE
-	0x2bc00000: 467, // luy
-	0x2bc000a3: 468, // luy-KE
-	0x2be00000: 469, // lv
-	0x2be000b7: 470, // lv-LV
-	0x2c800000: 471, // mas
-	0x2c8000a3: 472, // mas-KE
-	0x2c80012e: 473, // mas-TZ
-	0x2e000000: 474, // mer
-	0x2e0000a3: 475, // mer-KE
-	0x2e400000: 476, // mfe
-	0x2e4000cb: 477, // mfe-MU
-	0x2e800000: 478, // mg
-	0x2e8000be: 479, // mg-MG
-	0x2e900000: 480, // mgh
-	0x2e9000d0: 481, // mgh-MZ
-	0x2eb00000: 482, // mgo
-	0x2eb00051: 483, // mgo-CM
-	0x2f600000: 484, // mk
-	0x2f6000c1: 485, // mk-MK
-	0x2fb00000: 486, // ml
-	0x2fb00098: 487, // ml-IN
-	0x30200000: 488, // mn
-	0x302000c4: 489, // mn-MN
-	0x31200000: 490, // mr
-	0x31200098: 491, // mr-IN
-	0x31600000: 492, // ms
-	0x3160003d: 493, // ms-BN
-	0x316000cf: 494, // ms-MY
-	0x3160010c: 495, // ms-SG
-	0x31700000: 496, // mt
-	0x317000ca: 497, // mt-MT
-	0x31c00000: 498, // mua
-	0x31c00051: 499, // mua-CM
-	0x32800000: 500, // my
-	0x328000c3: 501, // my-MM
-	0x33100000: 502, // mzn
-	0x3310009b: 503, // mzn-IR
-	0x33800000: 504, // nah
-	0x33c00000: 505, // naq
-	0x33c000d1: 506, // naq-NA
-	0x33e00000: 507, // nb
-	0x33e000d9: 508, // nb-NO
-	0x33e0010f: 509, // nb-SJ
-	0x34500000: 510, // nd
-	0x34500163: 511, // nd-ZW
-	0x34700000: 512, // nds
-	0x3470005f: 513, // nds-DE
-	0x347000d8: 514, // nds-NL
-	0x34800000: 515, // ne
-	0x34800098: 516, // ne-IN
-	0x348000da: 517, // ne-NP
-	0x35e00000: 518, // nl
-	0x35e0002f: 519, // nl-AW
-	0x35e00035: 520, // nl-BE
-	0x35e0003f: 521, // nl-BQ
-	0x35e0005a: 522, // nl-CW
-	0x35e000d8: 523, // nl-NL
-	0x35e00115: 524, // nl-SR
-	0x35e0011a: 525, // nl-SX
-	0x35f00000: 526, // nmg
-	0x35f00051: 527, // nmg-CM
-	0x36100000: 528, // nn
-	0x361000d9: 529, // nn-NO
-	0x36300000: 530, // nnh
-	0x36300051: 531, // nnh-CM
-	0x36600000: 532, // no
-	0x36c00000: 533, // nqo
-	0x36d00000: 534, // nr
-	0x37100000: 535, // nso
-	0x37700000: 536, // nus
-	0x37700116: 537, // nus-SS
-	0x37e00000: 538, // ny
-	0x38000000: 539, // nyn
-	0x38000130: 540, // nyn-UG
-	0x38700000: 541, // om
-	0x3870006e: 542, // om-ET
-	0x387000a3: 543, // om-KE
-	0x38c00000: 544, // or
-	0x38c00098: 545, // or-IN
-	0x38f00000: 546, // os
-	0x38f0007c: 547, // os-GE
-	0x38f00105: 548, // os-RU
-	0x39400000: 549, // pa
-	0x39405000: 550, // pa-Arab
-	0x394050e7: 551, // pa-Arab-PK
-	0x3942f000: 552, // pa-Guru
-	0x3942f098: 553, // pa-Guru-IN
-	0x39800000: 554, // pap
-	0x3aa00000: 555, // pl
-	0x3aa000e8: 556, // pl-PL
-	0x3b400000: 557, // prg
-	0x3b400001: 558, // prg-001
-	0x3b500000: 559, // ps
-	0x3b500023: 560, // ps-AF
-	0x3b700000: 561, // pt
-	0x3b700029: 562, // pt-AO
-	0x3b700040: 563, // pt-BR
-	0x3b70004d: 564, // pt-CH
-	0x3b700059: 565, // pt-CV
-	0x3b700085: 566, // pt-GQ
-	0x3b70008a: 567, // pt-GW
-	0x3b7000b6: 568, // pt-LU
-	0x3b7000c5: 569, // pt-MO
-	0x3b7000d0: 570, // pt-MZ
-	0x3b7000ed: 571, // pt-PT
-	0x3b700117: 572, // pt-ST
-	0x3b700125: 573, // pt-TL
-	0x3bb00000: 574, // qu
-	0x3bb0003e: 575, // qu-BO
-	0x3bb00068: 576, // qu-EC
-	0x3bb000e3: 577, // qu-PE
-	0x3cb00000: 578, // rm
-	0x3cb0004d: 579, // rm-CH
-	0x3d000000: 580, // rn
-	0x3d000039: 581, // rn-BI
-	0x3d300000: 582, // ro
-	0x3d3000bb: 583, // ro-MD
-	0x3d300103: 584, // ro-RO
-	0x3d500000: 585, // rof
-	0x3d50012e: 586, // rof-TZ
-	0x3d900000: 587, // ru
-	0x3d900046: 588, // ru-BY
-	0x3d9000a4: 589, // ru-KG
-	0x3d9000ad: 590, // ru-KZ
-	0x3d9000bb: 591, // ru-MD
-	0x3d900105: 592, // ru-RU
-	0x3d90012f: 593, // ru-UA
-	0x3dc00000: 594, // rw
-	0x3dc00106: 595, // rw-RW
-	0x3dd00000: 596, // rwk
-	0x3dd0012e: 597, // rwk-TZ
-	0x3e200000: 598, // sah
-	0x3e200105: 599, // sah-RU
-	0x3e300000: 600, // saq
-	0x3e3000a3: 601, // saq-KE
-	0x3e900000: 602, // sbp
-	0x3e90012e: 603, // sbp-TZ
-	0x3f200000: 604, // sdh
-	0x3f300000: 605, // se
-	0x3f300071: 606, // se-FI
-	0x3f3000d9: 607, // se-NO
-	0x3f30010b: 608, // se-SE
-	0x3f500000: 609, // seh
-	0x3f5000d0: 610, // seh-MZ
-	0x3f700000: 611, // ses
-	0x3f7000c2: 612, // ses-ML
-	0x3f800000: 613, // sg
-	0x3f80004b: 614, // sg-CF
-	0x3fe00000: 615, // shi
-	0x3fe52000: 616, // shi-Latn
-	0x3fe520b9: 617, // shi-Latn-MA
-	0x3fed2000: 618, // shi-Tfng
-	0x3fed20b9: 619, // shi-Tfng-MA
-	0x40200000: 620, // si
-	0x402000b2: 621, // si-LK
-	0x40800000: 622, // sk
-	0x40800110: 623, // sk-SK
-	0x40c00000: 624, // sl
-	0x40c0010e: 625, // sl-SI
-	0x41200000: 626, // sma
-	0x41300000: 627, // smi
-	0x41400000: 628, // smj
-	0x41500000: 629, // smn
-	0x41500071: 630, // smn-FI
-	0x41800000: 631, // sms
-	0x41900000: 632, // sn
-	0x41900163: 633, // sn-ZW
-	0x41f00000: 634, // so
-	0x41f00061: 635, // so-DJ
-	0x41f0006e: 636, // so-ET
-	0x41f000a3: 637, // so-KE
-	0x41f00114: 638, // so-SO
-	0x42700000: 639, // sq
-	0x42700026: 640, // sq-AL
-	0x427000c1: 641, // sq-MK
-	0x4270014c: 642, // sq-XK
-	0x42800000: 643, // sr
-	0x4281e000: 644, // sr-Cyrl
-	0x4281e032: 645, // sr-Cyrl-BA
-	0x4281e0bc: 646, // sr-Cyrl-ME
-	0x4281e104: 647, // sr-Cyrl-RS
-	0x4281e14c: 648, // sr-Cyrl-XK
-	0x42852000: 649, // sr-Latn
-	0x42852032: 650, // sr-Latn-BA
-	0x428520bc: 651, // sr-Latn-ME
-	0x42852104: 652, // sr-Latn-RS
-	0x4285214c: 653, // sr-Latn-XK
-	0x42d00000: 654, // ss
-	0x43000000: 655, // ssy
-	0x43100000: 656, // st
-	0x43a00000: 657, // sv
-	0x43a00030: 658, // sv-AX
-	0x43a00071: 659, // sv-FI
-	0x43a0010b: 660, // sv-SE
-	0x43b00000: 661, // sw
-	0x43b0004a: 662, // sw-CD
-	0x43b000a3: 663, // sw-KE
-	0x43b0012e: 664, // sw-TZ
-	0x43b00130: 665, // sw-UG
-	0x44400000: 666, // syr
-	0x44600000: 667, // ta
-	0x44600098: 668, // ta-IN
-	0x446000b2: 669, // ta-LK
-	0x446000cf: 670, // ta-MY
-	0x4460010c: 671, // ta-SG
-	0x45700000: 672, // te
-	0x45700098: 673, // te-IN
-	0x45a00000: 674, // teo
-	0x45a000a3: 675, // teo-KE
-	0x45a00130: 676, // teo-UG
-	0x46100000: 677, // th
-	0x46100122: 678, // th-TH
-	0x46500000: 679, // ti
-	0x4650006c: 680, // ti-ER
-	0x4650006e: 681, // ti-ET
-	0x46700000: 682, // tig
-	0x46c00000: 683, // tk
-	0x46c00126: 684, // tk-TM
-	0x47600000: 685, // tn
-	0x47800000: 686, // to
-	0x47800128: 687, // to-TO
-	0x48000000: 688, // tr
-	0x4800005c: 689, // tr-CY
-	0x4800012a: 690, // tr-TR
-	0x48400000: 691, // ts
-	0x49a00000: 692, // twq
-	0x49a000d3: 693, // twq-NE
-	0x49f00000: 694, // tzm
-	0x49f000b9: 695, // tzm-MA
-	0x4a200000: 696, // ug
-	0x4a200052: 697, // ug-CN
-	0x4a400000: 698, // uk
-	0x4a40012f: 699, // uk-UA
-	0x4aa00000: 700, // ur
-	0x4aa00098: 701, // ur-IN
-	0x4aa000e7: 702, // ur-PK
-	0x4b200000: 703, // uz
-	0x4b205000: 704, // uz-Arab
-	0x4b205023: 705, // uz-Arab-AF
-	0x4b21e000: 706, // uz-Cyrl
-	0x4b21e136: 707, // uz-Cyrl-UZ
-	0x4b252000: 708, // uz-Latn
-	0x4b252136: 709, // uz-Latn-UZ
-	0x4b400000: 710, // vai
-	0x4b452000: 711, // vai-Latn
-	0x4b4520b3: 712, // vai-Latn-LR
-	0x4b4d9000: 713, // vai-Vaii
-	0x4b4d90b3: 714, // vai-Vaii-LR
-	0x4b600000: 715, // ve
-	0x4b900000: 716, // vi
-	0x4b90013d: 717, // vi-VN
-	0x4bf00000: 718, // vo
-	0x4bf00001: 719, // vo-001
-	0x4c200000: 720, // vun
-	0x4c20012e: 721, // vun-TZ
-	0x4c400000: 722, // wa
-	0x4c500000: 723, // wae
-	0x4c50004d: 724, // wae-CH
-	0x4db00000: 725, // wo
-	0x4e800000: 726, // xh
-	0x4f100000: 727, // xog
-	0x4f100130: 728, // xog-UG
-	0x4ff00000: 729, // yav
-	0x4ff00051: 730, // yav-CM
-	0x50800000: 731, // yi
-	0x50800001: 732, // yi-001
-	0x50e00000: 733, // yo
-	0x50e0003a: 734, // yo-BJ
-	0x50e000d5: 735, // yo-NG
-	0x51500000: 736, // yue
-	0x5150008c: 737, // yue-HK
-	0x51e00000: 738, // zgh
-	0x51e000b9: 739, // zgh-MA
-	0x51f00000: 740, // zh
-	0x51f34000: 741, // zh-Hans
-	0x51f34052: 742, // zh-Hans-CN
-	0x51f3408c: 743, // zh-Hans-HK
-	0x51f340c5: 744, // zh-Hans-MO
-	0x51f3410c: 745, // zh-Hans-SG
-	0x51f35000: 746, // zh-Hant
-	0x51f3508c: 747, // zh-Hant-HK
-	0x51f350c5: 748, // zh-Hant-MO
-	0x51f3512d: 749, // zh-Hant-TW
-	0x52400000: 750, // zu
-	0x52400160: 751, // zu-ZA
-}
-
-// Total table size 4580 bytes (4KiB); checksum: A7F72A2A
diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go
index 5eecceb61..b939c89f1 100644
--- a/vendor/golang.org/x/text/language/language.go
+++ b/vendor/golang.org/x/text/language/language.go
@@ -2,144 +2,42 @@
 // Use of this source code is governed by a BSD-style
 // license that can be found in the LICENSE file.
 
-//go:generate go run maketables.go gen_common.go -output tables.go
-//go:generate go run gen_index.go
+//go:generate go run gen.go -output tables.go
 
-// Package language implements BCP 47 language tags and related functionality.
-//
-// The Tag type, which is used to represent languages, is agnostic to the
-// meaning of its subtags. Tags are not fully canonicalized to preserve
-// information that may be valuable in certain contexts. As a consequence, two
-// different tags may represent identical languages.
-//
-// Initializing language- or locale-specific components usually consists of
-// two steps. The first step is to select a display language based on the
-// preferred languages of the user and the languages supported by an application.
-// The second step is to create the language-specific services based on
-// this selection. Each is discussed in more details below.
-//
-// Matching preferred against supported languages
-//
-// An application may support various languages. This list is typically limited
-// by the languages for which there exists translations of the user interface.
-// Similarly, a user may provide a list of preferred languages which is limited
-// by the languages understood by this user.
-// An application should use a Matcher to find the best supported language based
-// on the user's preferred list.
-// Matchers are aware of the intricacies of equivalence between languages.
-// The default Matcher implementation takes into account things such as
-// deprecated subtags, legacy tags, and mutual intelligibility between scripts
-// and languages.
-//
-// A Matcher for English, Australian English, Danish, and standard Mandarin can
-// be defined as follows:
-//
-//		var matcher = language.NewMatcher([]language.Tag{
-//			language.English,   // The first language is used as fallback.
-// 			language.MustParse("en-AU"),
-//			language.Danish,
-//			language.Chinese,
-//		})
-//
-// The following code selects the best match for someone speaking Spanish and
-// Norwegian:
-//
-// 		preferred := []language.Tag{ language.Spanish, language.Norwegian }
-//		tag, _, _ := matcher.Match(preferred...)
-//
-// In this case, the best match is Danish, as Danish is sufficiently a match to
-// Norwegian to not have to fall back to the default.
-// See ParseAcceptLanguage on how to handle the Accept-Language HTTP header.
-//
-// Selecting language-specific services
-//
-// One should always use the Tag returned by the Matcher to create an instance
-// of any of the language-specific services provided by the text repository.
-// This prevents the mixing of languages, such as having a different language for
-// messages and display names, as well as improper casing or sorting order for
-// the selected language.
-// Using the returned Tag also allows user-defined settings, such as collation
-// order or numbering system to be transparently passed as options.
-//
-// If you have language-specific data in your application, however, it will in
-// most cases suffice to use the index returned by the matcher to identify
-// the user language.
-// The following loop provides an alternative in case this is not sufficient:
-//
-// 		supported := map[language.Tag]data{
-//			language.English:            enData,
-// 			language.MustParse("en-AU"): enAUData,
-//			language.Danish:             daData,
-//			language.Chinese:            zhData,
-// 		}
-//		tag, _, _ := matcher.Match(preferred...)
-//		for ; tag != language.Und; tag = tag.Parent() {
-//			if v, ok := supported[tag]; ok {
-//				return v
-//			}
-//		}
-// 		return enData // should not reach here
-//
-// Repeatedly taking the Parent of the tag returned by Match will eventually
-// match one of the tags used to initialize the Matcher.
-//
-// Canonicalization
-//
-// By default, only legacy and deprecated tags are converted into their
-// canonical equivalent. All other information is preserved. This approach makes
-// the confidence scores more accurate and allows matchers to distinguish
-// between variants that are otherwise lost.
-//
-// As a consequence, two tags that should be treated as identical according to
-// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The
-// Matchers will handle such distinctions, though, and are aware of the
-// equivalence relations. The CanonType type can be used to alter the
-// canonicalization form.
-//
-// References
-//
-// BCP 47 - Tags for Identifying Languages
-// http://tools.ietf.org/html/bcp47
-package language // import "golang.org/x/text/language"
+package language
 
 // TODO: Remove above NOTE after:
 // - verifying that tables are dropped correctly (most notably matcher tables).
 
 import (
-	"errors"
-	"fmt"
 	"strings"
-)
 
-const (
-	// maxCoreSize is the maximum size of a BCP 47 tag without variants and
-	// extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
-	maxCoreSize = 12
-
-	// max99thPercentileSize is a somewhat arbitrary buffer size that presumably
-	// is large enough to hold at least 99% of the BCP 47 tags.
-	max99thPercentileSize = 32
-
-	// maxSimpleUExtensionSize is the maximum size of a -u extension with one
-	// key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
-	maxSimpleUExtensionSize = 14
+	"golang.org/x/text/internal/language"
+	"golang.org/x/text/internal/language/compact"
 )
 
 // Tag represents a BCP 47 language tag. It is used to specify an instance of a
 // specific language or locale. All language tag values are guaranteed to be
 // well-formed.
-type Tag struct {
-	lang     langID
-	region   regionID
-	script   scriptID
-	pVariant byte   // offset in str, includes preceding '-'
-	pExt     uint16 // offset of first extension, includes preceding '-'
+type Tag compact.Tag
+
+func makeTag(t language.Tag) (tag Tag) {
+	return Tag(compact.Make(t))
+}
 
-	// str is the string representation of the Tag. It will only be used if the
-	// tag has variants or extensions.
-	str string
+func (t *Tag) tag() language.Tag {
+	return (*compact.Tag)(t).Tag()
 }
 
+func (t *Tag) isCompact() bool {
+	return (*compact.Tag)(t).IsCompact()
+}
+
+// TODO: improve performance.
+func (t *Tag) lang() language.Language { return t.tag().LangID }
+func (t *Tag) region() language.Region { return t.tag().RegionID }
+func (t *Tag) script() language.Script { return t.tag().ScriptID }
+
 // Make is a convenience wrapper for Parse that omits the error.
 // In case of an error, a sensible default is returned.
 func Make(s string) Tag {
@@ -156,25 +54,13 @@ func (c CanonType) Make(s string) Tag {
 // Raw returns the raw base language, script and region, without making an
 // attempt to infer their values.
 func (t Tag) Raw() (b Base, s Script, r Region) {
-	return Base{t.lang}, Script{t.script}, Region{t.region}
-}
-
-// equalTags compares language, script and region subtags only.
-func (t Tag) equalTags(a Tag) bool {
-	return t.lang == a.lang && t.script == a.script && t.region == a.region
+	tt := t.tag()
+	return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID}
 }
 
 // IsRoot returns true if t is equal to language "und".
 func (t Tag) IsRoot() bool {
-	if int(t.pVariant) < len(t.str) {
-		return false
-	}
-	return t.equalTags(und)
-}
-
-// private reports whether the Tag consists solely of a private use tag.
-func (t Tag) private() bool {
-	return t.str != "" && t.pVariant == 0
+	return compact.Tag(t).IsRoot()
 }
 
 // CanonType can be used to enable or disable various types of canonicalization.
@@ -226,73 +112,73 @@ const (
 
 // canonicalize returns the canonicalized equivalent of the tag and
 // whether there was any change.
-func (t Tag) canonicalize(c CanonType) (Tag, bool) {
+func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) {
 	if c == Raw {
 		return t, false
 	}
 	changed := false
 	if c&SuppressScript != 0 {
-		if t.lang < langNoIndexOffset && uint8(t.script) == suppressScript[t.lang] {
-			t.script = 0
+		if t.LangID.SuppressScript() == t.ScriptID {
+			t.ScriptID = 0
 			changed = true
 		}
 	}
 	if c&canonLang != 0 {
 		for {
-			if l, aliasType := normLang(t.lang); l != t.lang {
+			if l, aliasType := t.LangID.Canonicalize(); l != t.LangID {
 				switch aliasType {
-				case langLegacy:
+				case language.Legacy:
 					if c&Legacy != 0 {
-						if t.lang == _sh && t.script == 0 {
-							t.script = _Latn
+						if t.LangID == _sh && t.ScriptID == 0 {
+							t.ScriptID = _Latn
 						}
-						t.lang = l
+						t.LangID = l
 						changed = true
 					}
-				case langMacro:
+				case language.Macro:
 					if c&Macro != 0 {
 						// We deviate here from CLDR. The mapping "nb" -> "no"
 						// qualifies as a typical Macro language mapping.  However,
 						// for legacy reasons, CLDR maps "no", the macro language
 						// code for Norwegian, to the dominant variant "nb". This
 						// change is currently under consideration for CLDR as well.
-						// See http://unicode.org/cldr/trac/ticket/2698 and also
-						// http://unicode.org/cldr/trac/ticket/1790 for some of the
+						// See https://unicode.org/cldr/trac/ticket/2698 and also
+						// https://unicode.org/cldr/trac/ticket/1790 for some of the
 						// practical implications. TODO: this check could be removed
 						// if CLDR adopts this change.
-						if c&CLDR == 0 || t.lang != _nb {
+						if c&CLDR == 0 || t.LangID != _nb {
 							changed = true
-							t.lang = l
+							t.LangID = l
 						}
 					}
-				case langDeprecated:
+				case language.Deprecated:
 					if c&DeprecatedBase != 0 {
-						if t.lang == _mo && t.region == 0 {
-							t.region = _MD
+						if t.LangID == _mo && t.RegionID == 0 {
+							t.RegionID = _MD
 						}
-						t.lang = l
+						t.LangID = l
 						changed = true
 						// Other canonicalization types may still apply.
 						continue
 					}
 				}
-			} else if c&Legacy != 0 && t.lang == _no && c&CLDR != 0 {
-				t.lang = _nb
+			} else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 {
+				t.LangID = _nb
 				changed = true
 			}
 			break
 		}
 	}
 	if c&DeprecatedScript != 0 {
-		if t.script == _Qaai {
+		if t.ScriptID == _Qaai {
 			changed = true
-			t.script = _Zinh
+			t.ScriptID = _Zinh
 		}
 	}
 	if c&DeprecatedRegion != 0 {
-		if r := normRegion(t.region); r != 0 {
+		if r := t.RegionID.Canonicalize(); r != t.RegionID {
 			changed = true
-			t.region = r
+			t.RegionID = r
 		}
 	}
 	return t, changed
@@ -300,11 +186,20 @@ func (t Tag) canonicalize(c CanonType) (Tag, bool) {
 
 // Canonicalize returns the canonicalized equivalent of the tag.
 func (c CanonType) Canonicalize(t Tag) (Tag, error) {
-	t, changed := t.canonicalize(c)
-	if changed {
-		t.remakeString()
+	// First try fast path.
+	if t.isCompact() {
+		if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed {
+			return t, nil
+		}
+	}
+	// It is unlikely that one will canonicalize a tag after matching. So do
+	// a slow but simple approach here.
+	if tag, changed := canonicalize(c, t.tag()); changed {
+		tag.RemakeString()
+		return makeTag(tag), nil
 	}
 	return t, nil
+
 }
 
 // Confidence indicates the level of certainty for a given return value.
@@ -327,79 +222,38 @@ func (c Confidence) String() string {
 	return confName[c]
 }
 
-// remakeString is used to update t.str in case lang, script or region changed.
-// It is assumed that pExt and pVariant still point to the start of the
-// respective parts.
-func (t *Tag) remakeString() {
-	if t.str == "" {
-		return
-	}
-	extra := t.str[t.pVariant:]
-	if t.pVariant > 0 {
-		extra = extra[1:]
-	}
-	if t.equalTags(und) && strings.HasPrefix(extra, "x-") {
-		t.str = extra
-		t.pVariant = 0
-		t.pExt = 0
-		return
-	}
-	var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
-	b := buf[:t.genCoreBytes(buf[:])]
-	if extra != "" {
-		diff := len(b) - int(t.pVariant)
-		b = append(b, '-')
-		b = append(b, extra...)
-		t.pVariant = uint8(int(t.pVariant) + diff)
-		t.pExt = uint16(int(t.pExt) + diff)
-	} else {
-		t.pVariant = uint8(len(b))
-		t.pExt = uint16(len(b))
-	}
-	t.str = string(b)
+// String returns the canonical string representation of the language tag.
+func (t Tag) String() string {
+	return t.tag().String()
 }
 
-// genCoreBytes writes a string for the base languages, script and region tags
-// to the given buffer and returns the number of bytes written. It will never
-// write more than maxCoreSize bytes.
-func (t *Tag) genCoreBytes(buf []byte) int {
-	n := t.lang.stringToBuf(buf[:])
-	if t.script != 0 {
-		n += copy(buf[n:], "-")
-		n += copy(buf[n:], t.script.String())
-	}
-	if t.region != 0 {
-		n += copy(buf[n:], "-")
-		n += copy(buf[n:], t.region.String())
-	}
-	return n
+// MarshalText implements encoding.TextMarshaler.
+func (t Tag) MarshalText() (text []byte, err error) {
+	return t.tag().MarshalText()
 }
 
-// String returns the canonical string representation of the language tag.
-func (t Tag) String() string {
-	if t.str != "" {
-		return t.str
-	}
-	if t.script == 0 && t.region == 0 {
-		return t.lang.String()
-	}
-	buf := [maxCoreSize]byte{}
-	return string(buf[:t.genCoreBytes(buf[:])])
+// UnmarshalText implements encoding.TextUnmarshaler.
+func (t *Tag) UnmarshalText(text []byte) error {
+	var tag language.Tag
+	err := tag.UnmarshalText(text)
+	*t = makeTag(tag)
+	return err
 }
 
 // Base returns the base language of the language tag. If the base language is
 // unspecified, an attempt will be made to infer it from the context.
 // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
 func (t Tag) Base() (Base, Confidence) {
-	if t.lang != 0 {
-		return Base{t.lang}, Exact
+	if b := t.lang(); b != 0 {
+		return Base{b}, Exact
 	}
+	tt := t.tag()
 	c := High
-	if t.script == 0 && !(Region{t.region}).IsCountry() {
+	if tt.ScriptID == 0 && !tt.RegionID.IsCountry() {
 		c = Low
 	}
-	if tag, err := addTags(t); err == nil && tag.lang != 0 {
-		return Base{tag.lang}, c
+	if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 {
+		return Base{tag.LangID}, c
 	}
 	return Base{0}, No
 }
@@ -412,35 +266,34 @@ func (t Tag) Base() (Base, Confidence) {
 // If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined)
 // as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks
 // common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts.
-// See http://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for
+// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for
 // unknown value in CLDR.  (Zzzz, Exact) is returned if Zzzz was explicitly specified.
 // Note that an inferred script is never guaranteed to be the correct one. Latin is
 // almost exclusively used for Afrikaans, but Arabic has been used for some texts
 // in the past.  Also, the script that is commonly used may change over time.
 // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
 func (t Tag) Script() (Script, Confidence) {
-	if t.script != 0 {
-		return Script{t.script}, Exact
-	}
-	sc, c := scriptID(_Zzzz), No
-	if t.lang < langNoIndexOffset {
-		if scr := scriptID(suppressScript[t.lang]); scr != 0 {
-			// Note: it is not always the case that a language with a suppress
-			// script value is only written in one script (e.g. kk, ms, pa).
-			if t.region == 0 {
-				return Script{scriptID(scr)}, High
-			}
-			sc, c = scr, High
+	if scr := t.script(); scr != 0 {
+		return Script{scr}, Exact
+	}
+	tt := t.tag()
+	sc, c := language.Script(_Zzzz), No
+	if scr := tt.LangID.SuppressScript(); scr != 0 {
+		// Note: it is not always the case that a language with a suppress
+		// script value is only written in one script (e.g. kk, ms, pa).
+		if tt.RegionID == 0 {
+			return Script{scr}, High
 		}
+		sc, c = scr, High
 	}
-	if tag, err := addTags(t); err == nil {
-		if tag.script != sc {
-			sc, c = tag.script, Low
+	if tag, err := tt.Maximize(); err == nil {
+		if tag.ScriptID != sc {
+			sc, c = tag.ScriptID, Low
 		}
 	} else {
-		t, _ = (Deprecated | Macro).Canonicalize(t)
-		if tag, err := addTags(t); err == nil && tag.script != sc {
-			sc, c = tag.script, Low
+		tt, _ = canonicalize(Deprecated|Macro, tt)
+		if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc {
+			sc, c = tag.ScriptID, Low
 		}
 	}
 	return Script{sc}, c
@@ -450,28 +303,31 @@ func (t Tag) Script() (Script, Confidence) {
 // infer a most likely candidate from the context.
 // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
 func (t Tag) Region() (Region, Confidence) {
-	if t.region != 0 {
-		return Region{t.region}, Exact
+	if r := t.region(); r != 0 {
+		return Region{r}, Exact
 	}
-	if t, err := addTags(t); err == nil {
-		return Region{t.region}, Low // TODO: differentiate between high and low.
+	tt := t.tag()
+	if tt, err := tt.Maximize(); err == nil {
+		return Region{tt.RegionID}, Low // TODO: differentiate between high and low.
 	}
-	t, _ = (Deprecated | Macro).Canonicalize(t)
-	if tag, err := addTags(t); err == nil {
-		return Region{tag.region}, Low
+	tt, _ = canonicalize(Deprecated|Macro, tt)
+	if tag, err := tt.Maximize(); err == nil {
+		return Region{tag.RegionID}, Low
 	}
 	return Region{_ZZ}, No // TODO: return world instead of undetermined?
 }
 
-// Variant returns the variants specified explicitly for this language tag.
+// Variants returns the variants specified explicitly for this language tag.
 // or nil if no variant was specified.
 func (t Tag) Variants() []Variant {
+	if !compact.Tag(t).MayHaveVariants() {
+		return nil
+	}
 	v := []Variant{}
-	if int(t.pVariant) < int(t.pExt) {
-		for x, str := "", t.str[t.pVariant:t.pExt]; str != ""; {
-			x, str = nextToken(str)
-			v = append(v, Variant{x})
-		}
+	x, str := "", t.tag().Variants()
+	for str != "" {
+		x, str = nextToken(str)
+		v = append(v, Variant{x})
 	}
 	return v
 }
@@ -479,57 +335,13 @@ func (t Tag) Variants() []Variant {
 // Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
 // specific language are substituted with fields from the parent language.
 // The parent for a language may change for newer versions of CLDR.
+//
+// Parent returns a tag for a less specific language that is mutually
+// intelligible or Und if there is no such language. This may not be the same as
+// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW"
+// is "zh-Hant", and the parent of "zh-Hant" is "und".
 func (t Tag) Parent() Tag {
-	if t.str != "" {
-		// Strip the variants and extensions.
-		t, _ = Raw.Compose(t.Raw())
-		if t.region == 0 && t.script != 0 && t.lang != 0 {
-			base, _ := addTags(Tag{lang: t.lang})
-			if base.script == t.script {
-				return Tag{lang: t.lang}
-			}
-		}
-		return t
-	}
-	if t.lang != 0 {
-		if t.region != 0 {
-			maxScript := t.script
-			if maxScript == 0 {
-				max, _ := addTags(t)
-				maxScript = max.script
-			}
-
-			for i := range parents {
-				if langID(parents[i].lang) == t.lang && scriptID(parents[i].maxScript) == maxScript {
-					for _, r := range parents[i].fromRegion {
-						if regionID(r) == t.region {
-							return Tag{
-								lang:   t.lang,
-								script: scriptID(parents[i].script),
-								region: regionID(parents[i].toRegion),
-							}
-						}
-					}
-				}
-			}
-
-			// Strip the script if it is the default one.
-			base, _ := addTags(Tag{lang: t.lang})
-			if base.script != maxScript {
-				return Tag{lang: t.lang, script: maxScript}
-			}
-			return Tag{lang: t.lang}
-		} else if t.script != 0 {
-			// The parent for an base-script pair with a non-default script is
-			// "und" instead of the base language.
-			base, _ := addTags(Tag{lang: t.lang})
-			if base.script != t.script {
-				return und
-			}
-			return Tag{lang: t.lang}
-		}
-	}
-	return und
+	return Tag(compact.Tag(t).Parent())
 }
 
 // returns token t and the rest of the string.
@@ -555,17 +367,8 @@ func (e Extension) String() string {
 
 // ParseExtension parses s as an extension and returns it on success.
 func ParseExtension(s string) (e Extension, err error) {
-	scan := makeScannerString(s)
-	var end int
-	if n := len(scan.token); n != 1 {
-		return Extension{}, errSyntax
-	}
-	scan.toLower(0, len(scan.b))
-	end = parseExtension(&scan)
-	if end != len(s) {
-		return Extension{}, errSyntax
-	}
-	return Extension{string(scan.b)}, nil
+	ext, err := language.ParseExtension(s)
+	return Extension{ext}, err
 }
 
 // Type returns the one-byte extension type of e. It returns 0 for the zero
@@ -586,22 +389,20 @@ func (e Extension) Tokens() []string {
 // false for ok if t does not have the requested extension. The returned
 // extension will be invalid in this case.
 func (t Tag) Extension(x byte) (ext Extension, ok bool) {
-	for i := int(t.pExt); i < len(t.str)-1; {
-		var ext string
-		i, ext = getExtension(t.str, i)
-		if ext[0] == x {
-			return Extension{ext}, true
-		}
+	if !compact.Tag(t).MayHaveExtensions() {
+		return Extension{}, false
 	}
-	return Extension{}, false
+	e, ok := t.tag().Extension(x)
+	return Extension{e}, ok
 }
 
 // Extensions returns all extensions of t.
 func (t Tag) Extensions() []Extension {
+	if !compact.Tag(t).MayHaveExtensions() {
+		return nil
+	}
 	e := []Extension{}
-	for i := int(t.pExt); i < len(t.str)-1; {
-		var ext string
-		i, ext = getExtension(t.str, i)
+	for _, ext := range t.tag().Extensions() {
 		e = append(e, Extension{ext})
 	}
 	return e
@@ -609,259 +410,105 @@ func (t Tag) Extensions() []Extension {
 
 // TypeForKey returns the type associated with the given key, where key and type
 // are of the allowed values defined for the Unicode locale extension ('u') in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
 // TypeForKey will traverse the inheritance chain to get the correct value.
 func (t Tag) TypeForKey(key string) string {
-	if start, end, _ := t.findTypeForKey(key); end != start {
-		return t.str[start:end]
+	if !compact.Tag(t).MayHaveExtensions() {
+		if key != "rg" && key != "va" {
+			return ""
+		}
 	}
-	return ""
+	return t.tag().TypeForKey(key)
 }
 
-var (
-	errPrivateUse       = errors.New("cannot set a key on a private use tag")
-	errInvalidArguments = errors.New("invalid key or type")
-)
-
 // SetTypeForKey returns a new Tag with the key set to type, where key and type
 // are of the allowed values defined for the Unicode locale extension ('u') in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
 // An empty value removes an existing pair with the same key.
 func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
-	if t.private() {
-		return t, errPrivateUse
-	}
-	if len(key) != 2 {
-		return t, errInvalidArguments
-	}
-
-	// Remove the setting if value is "".
-	if value == "" {
-		start, end, _ := t.findTypeForKey(key)
-		if start != end {
-			// Remove key tag and leading '-'.
-			start -= 4
-
-			// Remove a possible empty extension.
-			if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' {
-				start -= 2
-			}
-			if start == int(t.pVariant) && end == len(t.str) {
-				t.str = ""
-				t.pVariant, t.pExt = 0, 0
-			} else {
-				t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
-			}
-		}
-		return t, nil
-	}
-
-	if len(value) < 3 || len(value) > 8 {
-		return t, errInvalidArguments
-	}
-
-	var (
-		buf    [maxCoreSize + maxSimpleUExtensionSize]byte
-		uStart int // start of the -u extension.
-	)
-
-	// Generate the tag string if needed.
-	if t.str == "" {
-		uStart = t.genCoreBytes(buf[:])
-		buf[uStart] = '-'
-		uStart++
-	}
-
-	// Create new key-type pair and parse it to verify.
-	b := buf[uStart:]
-	copy(b, "u-")
-	copy(b[2:], key)
-	b[4] = '-'
-	b = b[:5+copy(b[5:], value)]
-	scan := makeScanner(b)
-	if parseExtensions(&scan); scan.err != nil {
-		return t, scan.err
-	}
-
-	// Assemble the replacement string.
-	if t.str == "" {
-		t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
-		t.str = string(buf[:uStart+len(b)])
-	} else {
-		s := t.str
-		start, end, hasExt := t.findTypeForKey(key)
-		if start == end {
-			if hasExt {
-				b = b[2:]
-			}
-			t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:])
-		} else {
-			t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:])
-		}
-	}
-	return t, nil
+	tt, err := t.tag().SetTypeForKey(key, value)
+	return makeTag(tt), err
 }
 
-// findKeyAndType returns the start and end position for the type corresponding
-// to key or the point at which to insert the key-value pair if the type
-// wasn't found. The hasExt return value reports whether an -u extension was present.
-// Note: the extensions are typically very small and are likely to contain
-// only one key-type pair.
-func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) {
-	p := int(t.pExt)
-	if len(key) != 2 || p == len(t.str) || p == 0 {
-		return p, p, false
-	}
-	s := t.str
-
-	// Find the correct extension.
-	for p++; s[p] != 'u'; p++ {
-		if s[p] > 'u' {
-			p--
-			return p, p, false
-		}
-		if p = nextExtension(s, p); p == len(s) {
-			return len(s), len(s), false
-		}
-	}
-	// Proceed to the hyphen following the extension name.
-	p++
-
-	// curKey is the key currently being processed.
-	curKey := ""
-
-	// Iterate over keys until we get the end of a section.
-	for {
-		// p points to the hyphen preceding the current token.
-		if p3 := p + 3; s[p3] == '-' {
-			// Found a key.
-			// Check whether we just processed the key that was requested.
-			if curKey == key {
-				return start, p, true
-			}
-			// Set to the next key and continue scanning type tokens.
-			curKey = s[p+1 : p3]
-			if curKey > key {
-				return p, p, true
-			}
-			// Start of the type token sequence.
-			start = p + 4
-			// A type is at least 3 characters long.
-			p += 7 // 4 + 3
-		} else {
-			// Attribute or type, which is at least 3 characters long.
-			p += 4
-		}
-		// p points past the third character of a type or attribute.
-		max := p + 5 // maximum length of token plus hyphen.
-		if len(s) < max {
-			max = len(s)
-		}
-		for ; p < max && s[p] != '-'; p++ {
-		}
-		// Bail if we have exhausted all tokens or if the next token starts
-		// a new extension.
-		if p == len(s) || s[p+2] == '-' {
-			if curKey == key {
-				return start, p, true
-			}
-			return p, p, true
-		}
-	}
-}
+// NumCompactTags is the number of compact tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = compact.NumCompactTags
 
 // CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags
-// for which data exists in the text repository. The index will change over time
-// and should not be stored in persistent storage. Extensions, except for the
-// 'va' type of the 'u' extension, are ignored. It will return 0, false if no
-// compact tag exists, where 0 is the index for the root language (Und).
-func CompactIndex(t Tag) (index int, ok bool) {
-	// TODO: perhaps give more frequent tags a lower index.
-	// TODO: we could make the indexes stable. This will excluded some
-	//       possibilities for optimization, so don't do this quite yet.
-	b, s, r := t.Raw()
-	if len(t.str) > 0 {
-		if strings.HasPrefix(t.str, "x-") {
-			// We have no entries for user-defined tags.
-			return 0, false
-		}
-		if uint16(t.pVariant) != t.pExt {
-			// There are no tags with variants and an u-va type.
-			if t.TypeForKey("va") != "" {
-				return 0, false
-			}
-			t, _ = Raw.Compose(b, s, r, t.Variants())
-		} else if _, ok := t.Extension('u'); ok {
-			// Strip all but the 'va' entry.
-			variant := t.TypeForKey("va")
-			t, _ = Raw.Compose(b, s, r)
-			t, _ = t.SetTypeForKey("va", variant)
-		}
-		if len(t.str) > 0 {
-			// We have some variants.
-			for i, s := range specialTags {
-				if s == t {
-					return i + 1, true
-				}
-			}
-			return 0, false
-		}
-	}
-	// No variants specified: just compare core components.
-	// The key has the form lllssrrr, where l, s, and r are nibbles for
-	// respectively the langID, scriptID, and regionID.
-	key := uint32(b.langID) << (8 + 12)
-	key |= uint32(s.scriptID) << 12
-	key |= uint32(r.regionID)
-	x, ok := coreTags[key]
-	return int(x), ok
+// for which data exists in the text repository.The index will change over time
+// and should not be stored in persistent storage. If t does not match a compact
+// index, exact will be false and the compact index will be returned for the
+// first match after repeatedly taking the Parent of t.
+func CompactIndex(t Tag) (index int, exact bool) {
+	id, exact := compact.LanguageID(compact.Tag(t))
+	return int(id), exact
 }
 
+var root = language.Tag{}
+
 // Base is an ISO 639 language code, used for encoding the base language
 // of a language tag.
 type Base struct {
-	langID
+	langID language.Language
 }
 
 // ParseBase parses a 2- or 3-letter ISO 639 code.
 // It returns a ValueError if s is a well-formed but unknown language identifier
 // or another error if another error occurred.
 func ParseBase(s string) (Base, error) {
-	if n := len(s); n < 2 || 3 < n {
-		return Base{}, errSyntax
-	}
-	var buf [3]byte
-	l, err := getLangID(buf[:copy(buf[:], s)])
+	l, err := language.ParseBase(s)
 	return Base{l}, err
 }
 
+// String returns the BCP 47 representation of the base language.
+func (b Base) String() string {
+	return b.langID.String()
+}
+
+// ISO3 returns the ISO 639-3 language code.
+func (b Base) ISO3() string {
+	return b.langID.ISO3()
+}
+
+// IsPrivateUse reports whether this language code is reserved for private use.
+func (b Base) IsPrivateUse() bool {
+	return b.langID.IsPrivateUse()
+}
+
 // Script is a 4-letter ISO 15924 code for representing scripts.
 // It is idiomatically represented in title case.
 type Script struct {
-	scriptID
+	scriptID language.Script
 }
 
 // ParseScript parses a 4-letter ISO 15924 code.
 // It returns a ValueError if s is a well-formed but unknown script identifier
 // or another error if another error occurred.
 func ParseScript(s string) (Script, error) {
-	if len(s) != 4 {
-		return Script{}, errSyntax
-	}
-	var buf [4]byte
-	sc, err := getScriptID(script, buf[:copy(buf[:], s)])
+	sc, err := language.ParseScript(s)
 	return Script{sc}, err
 }
 
+// String returns the script code in title case.
+// It returns "Zzzz" for an unspecified script.
+func (s Script) String() string {
+	return s.scriptID.String()
+}
+
+// IsPrivateUse reports whether this script code is reserved for private use.
+func (s Script) IsPrivateUse() bool {
+	return s.scriptID.IsPrivateUse()
+}
+
 // Region is an ISO 3166-1 or UN M.49 code for representing countries and regions.
 type Region struct {
-	regionID
+	regionID language.Region
 }
 
 // EncodeM49 returns the Region for the given UN M.49 code.
 // It returns an error if r is not a valid code.
 func EncodeM49(r int) (Region, error) {
-	rid, err := getRegionM49(r)
+	rid, err := language.EncodeM49(r)
 	return Region{rid}, err
 }
 
@@ -869,62 +516,54 @@ func EncodeM49(r int) (Region, error) {
 // It returns a ValueError if s is a well-formed but unknown region identifier
 // or another error if another error occurred.
 func ParseRegion(s string) (Region, error) {
-	if n := len(s); n < 2 || 3 < n {
-		return Region{}, errSyntax
-	}
-	var buf [3]byte
-	r, err := getRegionID(buf[:copy(buf[:], s)])
+	r, err := language.ParseRegion(s)
 	return Region{r}, err
 }
 
+// String returns the BCP 47 representation for the region.
+// It returns "ZZ" for an unspecified region.
+func (r Region) String() string {
+	return r.regionID.String()
+}
+
+// ISO3 returns the 3-letter ISO code of r.
+// Note that not all regions have a 3-letter ISO code.
+// In such cases this method returns "ZZZ".
+func (r Region) ISO3() string {
+	return r.regionID.String()
+}
+
+// M49 returns the UN M.49 encoding of r, or 0 if this encoding
+// is not defined for r.
+func (r Region) M49() int {
+	return r.regionID.M49()
+}
+
+// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
+// may include private-use tags that are assigned by CLDR and used in this
+// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
+func (r Region) IsPrivateUse() bool {
+	return r.regionID.IsPrivateUse()
+}
+
 // IsCountry returns whether this region is a country or autonomous area. This
 // includes non-standard definitions from CLDR.
 func (r Region) IsCountry() bool {
-	if r.regionID == 0 || r.IsGroup() || r.IsPrivateUse() && r.regionID != _XK {
-		return false
-	}
-	return true
+	return r.regionID.IsCountry()
 }
 
 // IsGroup returns whether this region defines a collection of regions. This
 // includes non-standard definitions from CLDR.
 func (r Region) IsGroup() bool {
-	if r.regionID == 0 {
-		return false
-	}
-	return int(regionInclusion[r.regionID]) < len(regionContainment)
+	return r.regionID.IsGroup()
 }
 
 // Contains returns whether Region c is contained by Region r. It returns true
 // if c == r.
 func (r Region) Contains(c Region) bool {
-	return r.regionID.contains(c.regionID)
+	return r.regionID.Contains(c.regionID)
 }
 
-func (r regionID) contains(c regionID) bool {
-	if r == c {
-		return true
-	}
-	g := regionInclusion[r]
-	if g >= nRegionGroups {
-		return false
-	}
-	m := regionContainment[g]
-
-	d := regionInclusion[c]
-	b := regionInclusionBits[d]
-
-	// A contained country may belong to multiple disjoint groups. Matching any
-	// of these indicates containment. If the contained region is a group, it
-	// must strictly be a subset.
-	if d >= nRegionGroups {
-		return b&m != 0
-	}
-	return b&^m == 0
-}
-
-var errNoTLD = errors.New("language: region is not a valid ccTLD")
-
 // TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
 // In all other cases it returns either the region itself or an error.
 //
@@ -933,25 +572,15 @@ var errNoTLD = errors.New("language: region is not a valid ccTLD")
 // region will already be canonicalized it was obtained from a Tag that was
 // obtained using any of the default methods.
 func (r Region) TLD() (Region, error) {
-	// See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
-	// difference between ISO 3166-1 and IANA ccTLD.
-	if r.regionID == _GB {
-		r = Region{_UK}
-	}
-	if (r.typ() & ccTLD) == 0 {
-		return Region{}, errNoTLD
-	}
-	return r, nil
+	tld, err := r.regionID.TLD()
+	return Region{tld}, err
 }
 
 // Canonicalize returns the region or a possible replacement if the region is
 // deprecated. It will not return a replacement for deprecated regions that
 // are split into multiple regions.
 func (r Region) Canonicalize() Region {
-	if cr := normRegion(r.regionID); cr != 0 {
-		return Region{cr}
-	}
-	return r
+	return Region{r.regionID.Canonicalize()}
 }
 
 // Variant represents a registered variant of a language as defined by BCP 47.
@@ -962,11 +591,8 @@ type Variant struct {
 // ParseVariant parses and returns a Variant. An error is returned if s is not
 // a valid variant.
 func ParseVariant(s string) (Variant, error) {
-	s = strings.ToLower(s)
-	if _, ok := variantIndex[s]; ok {
-		return Variant{s}, nil
-	}
-	return Variant{}, mkErrInvalid([]byte(s))
+	v, err := language.ParseVariant(s)
+	return Variant{v.String()}, err
 }
 
 // String returns the string representation of the variant.
diff --git a/vendor/golang.org/x/text/language/lookup.go b/vendor/golang.org/x/text/language/lookup.go
deleted file mode 100644
index 1d80ac370..000000000
--- a/vendor/golang.org/x/text/language/lookup.go
+++ /dev/null
@@ -1,396 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import (
-	"bytes"
-	"fmt"
-	"sort"
-	"strconv"
-
-	"golang.org/x/text/internal/tag"
-)
-
-// findIndex tries to find the given tag in idx and returns a standardized error
-// if it could not be found.
-func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
-	if !tag.FixCase(form, key) {
-		return 0, errSyntax
-	}
-	i := idx.Index(key)
-	if i == -1 {
-		return 0, mkErrInvalid(key)
-	}
-	return i, nil
-}
-
-func searchUint(imap []uint16, key uint16) int {
-	return sort.Search(len(imap), func(i int) bool {
-		return imap[i] >= key
-	})
-}
-
-type langID uint16
-
-// getLangID returns the langID of s if s is a canonical subtag
-// or langUnknown if s is not a canonical subtag.
-func getLangID(s []byte) (langID, error) {
-	if len(s) == 2 {
-		return getLangISO2(s)
-	}
-	return getLangISO3(s)
-}
-
-// mapLang returns the mapped langID of id according to mapping m.
-func normLang(id langID) (langID, langAliasType) {
-	k := sort.Search(len(langAliasMap), func(i int) bool {
-		return langAliasMap[i].from >= uint16(id)
-	})
-	if k < len(langAliasMap) && langAliasMap[k].from == uint16(id) {
-		return langID(langAliasMap[k].to), langAliasTypes[k]
-	}
-	return id, langAliasTypeUnknown
-}
-
-// getLangISO2 returns the langID for the given 2-letter ISO language code
-// or unknownLang if this does not exist.
-func getLangISO2(s []byte) (langID, error) {
-	if !tag.FixCase("zz", s) {
-		return 0, errSyntax
-	}
-	if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
-		return langID(i), nil
-	}
-	return 0, mkErrInvalid(s)
-}
-
-const base = 'z' - 'a' + 1
-
-func strToInt(s []byte) uint {
-	v := uint(0)
-	for i := 0; i < len(s); i++ {
-		v *= base
-		v += uint(s[i] - 'a')
-	}
-	return v
-}
-
-// converts the given integer to the original ASCII string passed to strToInt.
-// len(s) must match the number of characters obtained.
-func intToStr(v uint, s []byte) {
-	for i := len(s) - 1; i >= 0; i-- {
-		s[i] = byte(v%base) + 'a'
-		v /= base
-	}
-}
-
-// getLangISO3 returns the langID for the given 3-letter ISO language code
-// or unknownLang if this does not exist.
-func getLangISO3(s []byte) (langID, error) {
-	if tag.FixCase("und", s) {
-		// first try to match canonical 3-letter entries
-		for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
-			if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] {
-				// We treat "und" as special and always translate it to "unspecified".
-				// Note that ZZ and Zzzz are private use and are not treated as
-				// unspecified by default.
-				id := langID(i)
-				if id == nonCanonicalUnd {
-					return 0, nil
-				}
-				return id, nil
-			}
-		}
-		if i := altLangISO3.Index(s); i != -1 {
-			return langID(altLangIndex[altLangISO3.Elem(i)[3]]), nil
-		}
-		n := strToInt(s)
-		if langNoIndex[n/8]&(1<<(n%8)) != 0 {
-			return langID(n) + langNoIndexOffset, nil
-		}
-		// Check for non-canonical uses of ISO3.
-		for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
-			if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
-				return langID(i), nil
-			}
-		}
-		return 0, mkErrInvalid(s)
-	}
-	return 0, errSyntax
-}
-
-// stringToBuf writes the string to b and returns the number of bytes
-// written.  cap(b) must be >= 3.
-func (id langID) stringToBuf(b []byte) int {
-	if id >= langNoIndexOffset {
-		intToStr(uint(id)-langNoIndexOffset, b[:3])
-		return 3
-	} else if id == 0 {
-		return copy(b, "und")
-	}
-	l := lang[id<<2:]
-	if l[3] == 0 {
-		return copy(b, l[:3])
-	}
-	return copy(b, l[:2])
-}
-
-// String returns the BCP 47 representation of the langID.
-// Use b as variable name, instead of id, to ensure the variable
-// used is consistent with that of Base in which this type is embedded.
-func (b langID) String() string {
-	if b == 0 {
-		return "und"
-	} else if b >= langNoIndexOffset {
-		b -= langNoIndexOffset
-		buf := [3]byte{}
-		intToStr(uint(b), buf[:])
-		return string(buf[:])
-	}
-	l := lang.Elem(int(b))
-	if l[3] == 0 {
-		return l[:3]
-	}
-	return l[:2]
-}
-
-// ISO3 returns the ISO 639-3 language code.
-func (b langID) ISO3() string {
-	if b == 0 || b >= langNoIndexOffset {
-		return b.String()
-	}
-	l := lang.Elem(int(b))
-	if l[3] == 0 {
-		return l[:3]
-	} else if l[2] == 0 {
-		return altLangISO3.Elem(int(l[3]))[:3]
-	}
-	// This allocation will only happen for 3-letter ISO codes
-	// that are non-canonical BCP 47 language identifiers.
-	return l[0:1] + l[2:4]
-}
-
-// IsPrivateUse reports whether this language code is reserved for private use.
-func (b langID) IsPrivateUse() bool {
-	return langPrivateStart <= b && b <= langPrivateEnd
-}
-
-type regionID uint16
-
-// getRegionID returns the region id for s if s is a valid 2-letter region code
-// or unknownRegion.
-func getRegionID(s []byte) (regionID, error) {
-	if len(s) == 3 {
-		if isAlpha(s[0]) {
-			return getRegionISO3(s)
-		}
-		if i, err := strconv.ParseUint(string(s), 10, 10); err == nil {
-			return getRegionM49(int(i))
-		}
-	}
-	return getRegionISO2(s)
-}
-
-// getRegionISO2 returns the regionID for the given 2-letter ISO country code
-// or unknownRegion if this does not exist.
-func getRegionISO2(s []byte) (regionID, error) {
-	i, err := findIndex(regionISO, s, "ZZ")
-	if err != nil {
-		return 0, err
-	}
-	return regionID(i) + isoRegionOffset, nil
-}
-
-// getRegionISO3 returns the regionID for the given 3-letter ISO country code
-// or unknownRegion if this does not exist.
-func getRegionISO3(s []byte) (regionID, error) {
-	if tag.FixCase("ZZZ", s) {
-		for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
-			if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
-				return regionID(i) + isoRegionOffset, nil
-			}
-		}
-		for i := 0; i < len(altRegionISO3); i += 3 {
-			if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
-				return regionID(altRegionIDs[i/3]), nil
-			}
-		}
-		return 0, mkErrInvalid(s)
-	}
-	return 0, errSyntax
-}
-
-func getRegionM49(n int) (regionID, error) {
-	if 0 < n && n <= 999 {
-		const (
-			searchBits = 7
-			regionBits = 9
-			regionMask = 1<<regionBits - 1
-		)
-		idx := n >> searchBits
-		buf := fromM49[m49Index[idx]:m49Index[idx+1]]
-		val := uint16(n) << regionBits // we rely on bits shifting out
-		i := sort.Search(len(buf), func(i int) bool {
-			return buf[i] >= val
-		})
-		if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
-			return regionID(r & regionMask), nil
-		}
-	}
-	var e ValueError
-	fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n)
-	return 0, e
-}
-
-// normRegion returns a region if r is deprecated or 0 otherwise.
-// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
-// TODO: consider mapping split up regions to new most populous one (like CLDR).
-func normRegion(r regionID) regionID {
-	m := regionOldMap
-	k := sort.Search(len(m), func(i int) bool {
-		return m[i].from >= uint16(r)
-	})
-	if k < len(m) && m[k].from == uint16(r) {
-		return regionID(m[k].to)
-	}
-	return 0
-}
-
-const (
-	iso3166UserAssigned = 1 << iota
-	ccTLD
-	bcp47Region
-)
-
-func (r regionID) typ() byte {
-	return regionTypes[r]
-}
-
-// String returns the BCP 47 representation for the region.
-// It returns "ZZ" for an unspecified region.
-func (r regionID) String() string {
-	if r < isoRegionOffset {
-		if r == 0 {
-			return "ZZ"
-		}
-		return fmt.Sprintf("%03d", r.M49())
-	}
-	r -= isoRegionOffset
-	return regionISO.Elem(int(r))[:2]
-}
-
-// ISO3 returns the 3-letter ISO code of r.
-// Note that not all regions have a 3-letter ISO code.
-// In such cases this method returns "ZZZ".
-func (r regionID) ISO3() string {
-	if r < isoRegionOffset {
-		return "ZZZ"
-	}
-	r -= isoRegionOffset
-	reg := regionISO.Elem(int(r))
-	switch reg[2] {
-	case 0:
-		return altRegionISO3[reg[3]:][:3]
-	case ' ':
-		return "ZZZ"
-	}
-	return reg[0:1] + reg[2:4]
-}
-
-// M49 returns the UN M.49 encoding of r, or 0 if this encoding
-// is not defined for r.
-func (r regionID) M49() int {
-	return int(m49[r])
-}
-
-// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
-// may include private-use tags that are assigned by CLDR and used in this
-// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
-func (r regionID) IsPrivateUse() bool {
-	return r.typ()&iso3166UserAssigned != 0
-}
-
-type scriptID uint8
-
-// getScriptID returns the script id for string s. It assumes that s
-// is of the format [A-Z][a-z]{3}.
-func getScriptID(idx tag.Index, s []byte) (scriptID, error) {
-	i, err := findIndex(idx, s, "Zzzz")
-	return scriptID(i), err
-}
-
-// String returns the script code in title case.
-// It returns "Zzzz" for an unspecified script.
-func (s scriptID) String() string {
-	if s == 0 {
-		return "Zzzz"
-	}
-	return script.Elem(int(s))
-}
-
-// IsPrivateUse reports whether this script code is reserved for private use.
-func (s scriptID) IsPrivateUse() bool {
-	return _Qaaa <= s && s <= _Qabx
-}
-
-const (
-	maxAltTaglen = len("en-US-POSIX")
-	maxLen       = maxAltTaglen
-)
-
-var (
-	// grandfatheredMap holds a mapping from legacy and grandfathered tags to
-	// their base language or index to more elaborate tag.
-	grandfatheredMap = map[[maxLen]byte]int16{
-		[maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban
-		[maxLen]byte{'i', '-', 'a', 'm', 'i'}:                          _ami, // i-ami
-		[maxLen]byte{'i', '-', 'b', 'n', 'n'}:                          _bnn, // i-bnn
-		[maxLen]byte{'i', '-', 'h', 'a', 'k'}:                          _hak, // i-hak
-		[maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}:      _tlh, // i-klingon
-		[maxLen]byte{'i', '-', 'l', 'u', 'x'}:                          _lb,  // i-lux
-		[maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}:           _nv,  // i-navajo
-		[maxLen]byte{'i', '-', 'p', 'w', 'n'}:                          _pwn, // i-pwn
-		[maxLen]byte{'i', '-', 't', 'a', 'o'}:                          _tao, // i-tao
-		[maxLen]byte{'i', '-', 't', 'a', 'y'}:                          _tay, // i-tay
-		[maxLen]byte{'i', '-', 't', 's', 'u'}:                          _tsu, // i-tsu
-		[maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}:                     _nb,  // no-bok
-		[maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}:                     _nn,  // no-nyn
-		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}:      _sfb, // sgn-BE-FR
-		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}:      _vgt, // sgn-BE-NL
-		[maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}:      _sgg, // sgn-CH-DE
-		[maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}:           _cmn, // zh-guoyu
-		[maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}:           _hak, // zh-hakka
-		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan
-		[maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}:           _hsn, // zh-xiang
-
-		// Grandfathered tags with no modern replacement will be converted as
-		// follows:
-		[maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish
-		[maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}:           -2, // en-GB-oed
-		[maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}:           -3, // i-default
-		[maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}:      -4, // i-enochian
-		[maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}:                     -5, // i-mingo
-		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}:                          -6, // zh-min
-
-		// CLDR-specific tag.
-		[maxLen]byte{'r', 'o', 'o', 't'}:                                    0,  // root
-		[maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX"
-	}
-
-	altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102}
-
-	altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix"
-)
-
-func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) {
-	if v, ok := grandfatheredMap[s]; ok {
-		if v < 0 {
-			return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
-		}
-		t.lang = langID(v)
-		return t, true
-	}
-	return t, false
-}
diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go
index 8ad950533..f73492134 100644
--- a/vendor/golang.org/x/text/language/match.go
+++ b/vendor/golang.org/x/text/language/match.go
@@ -4,7 +4,45 @@
 
 package language
 
-import "errors"
+import (
+	"errors"
+	"strings"
+
+	"golang.org/x/text/internal/language"
+)
+
+// A MatchOption configures a Matcher.
+type MatchOption func(*matcher)
+
+// PreferSameScript will, in the absence of a match, result in the first
+// preferred tag with the same script as a supported tag to match this supported
+// tag. The default is currently true, but this may change in the future.
+func PreferSameScript(preferSame bool) MatchOption {
+	return func(m *matcher) { m.preferSameScript = preferSame }
+}
+
+// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface.
+// There doesn't seem to be too much need for multiple types.
+// Making it a concrete type allows MatchStrings to be a method, which will
+// improve its discoverability.
+
+// MatchStrings parses and matches the given strings until one of them matches
+// the language in the Matcher. A string may be an Accept-Language header as
+// handled by ParseAcceptLanguage. The default language is returned if no
+// other language matched.
+func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) {
+	for _, accept := range lang {
+		desired, _, err := ParseAcceptLanguage(accept)
+		if err != nil {
+			continue
+		}
+		if tag, index, conf := m.Match(desired...); conf != No {
+			return tag, index
+		}
+	}
+	tag, index, _ = m.Match()
+	return
+}
 
 // Matcher is the interface that wraps the Match method.
 //
@@ -36,248 +74,76 @@ func Comprehends(speaker, alternative Tag) Confidence {
 // matched tag in t, but is augmented with the Unicode extension ('u')of the
 // corresponding preferred tag. This allows user locale options to be passed
 // transparently.
-func NewMatcher(t []Tag) Matcher {
-	return newMatcher(t)
+func NewMatcher(t []Tag, options ...MatchOption) Matcher {
+	return newMatcher(t, options)
 }
 
 func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) {
+	var tt language.Tag
 	match, w, c := m.getBest(want...)
-	if match == nil {
-		t = m.default_.tag
+	if match != nil {
+		tt, index = match.tag, match.index
 	} else {
-		t, index = match.tag, match.index
-	}
-	// Copy options from the user-provided tag into the result tag. This is hard
-	// to do after the fact, so we do it here.
-	// TODO: consider also adding in variants that are compatible with the
-	// matched language.
-	// TODO: Add back region if it is non-ambiguous? Or create another tag to
-	// preserve the region?
-	if u, ok := w.Extension('u'); ok {
-		t, _ = Raw.Compose(t, u)
-	}
-	return t, index, c
-}
-
-type scriptRegionFlags uint8
-
-const (
-	isList = 1 << iota
-	scriptInFrom
-	regionInFrom
-)
-
-func (t *Tag) setUndefinedLang(id langID) {
-	if t.lang == 0 {
-		t.lang = id
-	}
-}
-
-func (t *Tag) setUndefinedScript(id scriptID) {
-	if t.script == 0 {
-		t.script = id
-	}
-}
-
-func (t *Tag) setUndefinedRegion(id regionID) {
-	if t.region == 0 || t.region.contains(id) {
-		t.region = id
-	}
-}
-
-// ErrMissingLikelyTagsData indicates no information was available
-// to compute likely values of missing tags.
-var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
-
-// addLikelySubtags sets subtags to their most likely value, given the locale.
-// In most cases this means setting fields for unknown values, but in some
-// cases it may alter a value.  It returns a ErrMissingLikelyTagsData error
-// if the given locale cannot be expanded.
-func (t Tag) addLikelySubtags() (Tag, error) {
-	id, err := addTags(t)
-	if err != nil {
-		return t, err
-	} else if id.equalTags(t) {
-		return t, nil
-	}
-	id.remakeString()
-	return id, nil
-}
-
-// specializeRegion attempts to specialize a group region.
-func specializeRegion(t *Tag) bool {
-	if i := regionInclusion[t.region]; i < nRegionGroups {
-		x := likelyRegionGroup[i]
-		if langID(x.lang) == t.lang && scriptID(x.script) == t.script {
-			t.region = regionID(x.region)
-		}
-		return true
-	}
-	return false
-}
-
-func addTags(t Tag) (Tag, error) {
-	// We leave private use identifiers alone.
-	if t.private() {
-		return t, nil
-	}
-	if t.script != 0 && t.region != 0 {
-		if t.lang != 0 {
-			// already fully specified
-			specializeRegion(&t)
-			return t, nil
-		}
-		// Search matches for und-script-region. Note that for these cases
-		// region will never be a group so there is no need to check for this.
-		list := likelyRegion[t.region : t.region+1]
-		if x := list[0]; x.flags&isList != 0 {
-			list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
-		}
-		for _, x := range list {
-			// Deviating from the spec. See match_test.go for details.
-			if scriptID(x.script) == t.script {
-				t.setUndefinedLang(langID(x.lang))
-				return t, nil
-			}
-		}
-	}
-	if t.lang != 0 {
-		// Search matches for lang-script and lang-region, where lang != und.
-		if t.lang < langNoIndexOffset {
-			x := likelyLang[t.lang]
-			if x.flags&isList != 0 {
-				list := likelyLangList[x.region : x.region+uint16(x.script)]
-				if t.script != 0 {
-					for _, x := range list {
-						if scriptID(x.script) == t.script && x.flags&scriptInFrom != 0 {
-							t.setUndefinedRegion(regionID(x.region))
-							return t, nil
-						}
-					}
-				} else if t.region != 0 {
-					count := 0
-					goodScript := true
-					tt := t
-					for _, x := range list {
-						// We visit all entries for which the script was not
-						// defined, including the ones where the region was not
-						// defined. This allows for proper disambiguation within
-						// regions.
-						if x.flags&scriptInFrom == 0 && t.region.contains(regionID(x.region)) {
-							tt.region = regionID(x.region)
-							tt.setUndefinedScript(scriptID(x.script))
-							goodScript = goodScript && tt.script == scriptID(x.script)
-							count++
-						}
-					}
-					if count == 1 {
-						return tt, nil
-					}
-					// Even if we fail to find a unique Region, we might have
-					// an unambiguous script.
-					if goodScript {
-						t.script = tt.script
-					}
+		// TODO: this should be an option
+		tt = m.default_.tag
+		if m.preferSameScript {
+		outer:
+			for _, w := range want {
+				script, _ := w.Script()
+				if script.scriptID == 0 {
+					// Don't do anything if there is no script, such as with
+					// private subtags.
+					continue
 				}
-			}
-		}
-	} else {
-		// Search matches for und-script.
-		if t.script != 0 {
-			x := likelyScript[t.script]
-			if x.region != 0 {
-				t.setUndefinedRegion(regionID(x.region))
-				t.setUndefinedLang(langID(x.lang))
-				return t, nil
-			}
-		}
-		// Search matches for und-region. If und-script-region exists, it would
-		// have been found earlier.
-		if t.region != 0 {
-			if i := regionInclusion[t.region]; i < nRegionGroups {
-				x := likelyRegionGroup[i]
-				if x.region != 0 {
-					t.setUndefinedLang(langID(x.lang))
-					t.setUndefinedScript(scriptID(x.script))
-					t.region = regionID(x.region)
-				}
-			} else {
-				x := likelyRegion[t.region]
-				if x.flags&isList != 0 {
-					x = likelyRegionList[x.lang]
-				}
-				if x.script != 0 && x.flags != scriptInFrom {
-					t.setUndefinedLang(langID(x.lang))
-					t.setUndefinedScript(scriptID(x.script))
-					return t, nil
+				for i, h := range m.supported {
+					if script.scriptID == h.maxScript {
+						tt, index = h.tag, i
+						break outer
+					}
 				}
 			}
 		}
+		// TODO: select first language tag based on script.
 	}
-
-	// Search matches for lang.
-	if t.lang < langNoIndexOffset {
-		x := likelyLang[t.lang]
-		if x.flags&isList != 0 {
-			x = likelyLangList[x.region]
+	if w.RegionID != tt.RegionID && w.RegionID != 0 {
+		if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) {
+			tt.RegionID = w.RegionID
+			tt.RemakeString()
+		} else if r := w.RegionID.String(); len(r) == 2 {
+			// TODO: also filter macro and deprecated.
+			tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz")
 		}
-		if x.region != 0 {
-			t.setUndefinedScript(scriptID(x.script))
-			t.setUndefinedRegion(regionID(x.region))
-		}
-		specializeRegion(&t)
-		if t.lang == 0 {
-			t.lang = _en // default language
+	}
+	// Copy options from the user-provided tag into the result tag. This is hard
+	// to do after the fact, so we do it here.
+	// TODO: add in alternative variants to -u-va-.
+	// TODO: add preferred region to -u-rg-.
+	if e := w.Extensions(); len(e) > 0 {
+		b := language.Builder{}
+		b.SetTag(tt)
+		for _, e := range e {
+			b.AddExt(e)
 		}
-		return t, nil
+		tt = b.Make()
 	}
-	return t, ErrMissingLikelyTagsData
+	return makeTag(tt), index, c
 }
 
-func (t *Tag) setTagsFrom(id Tag) {
-	t.lang = id.lang
-	t.script = id.script
-	t.region = id.region
-}
+// ErrMissingLikelyTagsData indicates no information was available
+// to compute likely values of missing tags.
+var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
 
-// minimize removes the region or script subtags from t such that
-// t.addLikelySubtags() == t.minimize().addLikelySubtags().
-func (t Tag) minimize() (Tag, error) {
-	t, err := minimizeTags(t)
-	if err != nil {
-		return t, err
-	}
-	t.remakeString()
-	return t, nil
-}
-
-// minimizeTags mimics the behavior of the ICU 51 C implementation.
-func minimizeTags(t Tag) (Tag, error) {
-	if t.equalTags(und) {
-		return t, nil
-	}
-	max, err := addTags(t)
-	if err != nil {
-		return t, err
-	}
-	for _, id := range [...]Tag{
-		{lang: t.lang},
-		{lang: t.lang, region: t.region},
-		{lang: t.lang, script: t.script},
-	} {
-		if x, err := addTags(id); err == nil && max.equalTags(x) {
-			t.setTagsFrom(id)
-			break
-		}
-	}
-	return t, nil
-}
+// func (t *Tag) setTagsFrom(id Tag) {
+// 	t.LangID = id.LangID
+// 	t.ScriptID = id.ScriptID
+// 	t.RegionID = id.RegionID
+// }
 
 // Tag Matching
 // CLDR defines an algorithm for finding the best match between two sets of language
 // tags. The basic algorithm defines how to score a possible match and then find
 // the match with the best score
-// (see http://www.unicode.org/reports/tr35/#LanguageMatching).
+// (see https://www.unicode.org/reports/tr35/#LanguageMatching).
 // Using scoring has several disadvantages. The scoring obfuscates the importance of
 // the various factors considered, making the algorithm harder to understand. Using
 // scoring also requires the full score to be computed for each pair of tags.
@@ -300,8 +166,9 @@ func minimizeTags(t Tag) (Tag, error) {
 //        1) compute the match between the two tags.
 //        2) if the match is better than the previous best match, replace it
 //           with the new match. (see next section)
-//     b) if the current best match is above a certain threshold, return this
-//        match without proceeding to the next tag in "desired". [See Note 1]
+//     b) if the current best match is Exact and pin is true the result will be
+//        frozen to the language found thusfar, although better matches may
+//        still be found for the same language.
 //   3) If the best match so far is below a certain threshold, return "default".
 //
 // Ranking:
@@ -350,9 +217,6 @@ func minimizeTags(t Tag) (Tag, error) {
 // found wins.
 //
 // Notes:
-// [1] Note that even if we may not have a perfect match, if a match is above a
-//     certain threshold, it is considered a better match than any other match
-//     to a tag later in the list of preferred language tags.
 // [2] In practice, as matching of Exact is done in a separate phase from
 //     matching the other levels, we reuse the Exact level to mean MaxExact in
 //     the second phase. As a consequence, we only need the levels defined by
@@ -388,22 +252,24 @@ func minimizeTags(t Tag) (Tag, error) {
 
 // matcher keeps a set of supported language tags, indexed by language.
 type matcher struct {
-	default_     *haveTag
-	index        map[langID]*matchHeader
-	passSettings bool
+	default_         *haveTag
+	supported        []*haveTag
+	index            map[language.Language]*matchHeader
+	passSettings     bool
+	preferSameScript bool
 }
 
 // matchHeader has the lists of tags for exact matches and matches based on
 // maximized and canonicalized tags for a given language.
 type matchHeader struct {
-	exact []*haveTag
-	max   []*haveTag
+	haveTags []*haveTag
+	original bool
 }
 
 // haveTag holds a supported Tag and its maximized script and region. The maximized
 // or canonicalized language is not stored as it is not needed during matching.
 type haveTag struct {
-	tag Tag
+	tag language.Tag
 
 	// index of this tag in the original list of supported tags.
 	index int
@@ -413,35 +279,37 @@ type haveTag struct {
 	conf Confidence
 
 	// Maximized region and script.
-	maxRegion regionID
-	maxScript scriptID
+	maxRegion language.Region
+	maxScript language.Script
 
 	// altScript may be checked as an alternative match to maxScript. If altScript
 	// matches, the confidence level for this match is Low. Theoretically there
 	// could be multiple alternative scripts. This does not occur in practice.
-	altScript scriptID
+	altScript language.Script
 
 	// nextMax is the index of the next haveTag with the same maximized tags.
 	nextMax uint16
 }
 
-func makeHaveTag(tag Tag, index int) (haveTag, langID) {
+func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) {
 	max := tag
-	if tag.lang != 0 {
-		max, _ = max.canonicalize(All)
-		max, _ = addTags(max)
-		max.remakeString()
+	if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 {
+		max, _ = canonicalize(All, max)
+		max, _ = max.Maximize()
+		max.RemakeString()
 	}
-	return haveTag{tag, index, Exact, max.region, max.script, altScript(max.lang, max.script), 0}, max.lang
+	return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID
 }
 
 // altScript returns an alternative script that may match the given script with
 // a low confidence.  At the moment, the langMatch data allows for at most one
 // script to map to another and we rely on this to keep the code simple.
-func altScript(l langID, s scriptID) scriptID {
+func altScript(l language.Language, s language.Script) language.Script {
 	for _, alt := range matchScript {
-		if (alt.lang == 0 || langID(alt.lang) == l) && scriptID(alt.have) == s {
-			return scriptID(alt.want)
+		// TODO: also match cases where language is not the same.
+		if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) &&
+			language.Script(alt.haveScript) == s {
+			return language.Script(alt.wantScript)
 		}
 	}
 	return 0
@@ -450,34 +318,32 @@ func altScript(l langID, s scriptID) scriptID {
 // addIfNew adds a haveTag to the list of tags only if it is a unique tag.
 // Tags that have the same maximized values are linked by index.
 func (h *matchHeader) addIfNew(n haveTag, exact bool) {
+	h.original = h.original || exact
 	// Don't add new exact matches.
-	for _, v := range h.exact {
-		if v.tag.equalsRest(n.tag) {
+	for _, v := range h.haveTags {
+		if equalsRest(v.tag, n.tag) {
 			return
 		}
 	}
-	if exact {
-		h.exact = append(h.exact, &n)
-	}
 	// Allow duplicate maximized tags, but create a linked list to allow quickly
 	// comparing the equivalents and bail out.
-	for i, v := range h.max {
+	for i, v := range h.haveTags {
 		if v.maxScript == n.maxScript &&
 			v.maxRegion == n.maxRegion &&
-			v.tag.variantOrPrivateTagStr() == n.tag.variantOrPrivateTagStr() {
-			for h.max[i].nextMax != 0 {
-				i = int(h.max[i].nextMax)
+			v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() {
+			for h.haveTags[i].nextMax != 0 {
+				i = int(h.haveTags[i].nextMax)
 			}
-			h.max[i].nextMax = uint16(len(h.max))
+			h.haveTags[i].nextMax = uint16(len(h.haveTags))
 			break
 		}
 	}
-	h.max = append(h.max, &n)
+	h.haveTags = append(h.haveTags, &n)
 }
 
 // header returns the matchHeader for the given language. It creates one if
 // it doesn't already exist.
-func (m *matcher) header(l langID) *matchHeader {
+func (m *matcher) header(l language.Language) *matchHeader {
 	if h := m.index[l]; h != nil {
 		return h
 	}
@@ -486,12 +352,26 @@ func (m *matcher) header(l langID) *matchHeader {
 	return h
 }
 
+func toConf(d uint8) Confidence {
+	if d <= 10 {
+		return High
+	}
+	if d < 30 {
+		return Low
+	}
+	return No
+}
+
 // newMatcher builds an index for the given supported tags and returns it as
 // a matcher. It also expands the index by considering various equivalence classes
 // for a given tag.
-func newMatcher(supported []Tag) *matcher {
+func newMatcher(supported []Tag, options []MatchOption) *matcher {
 	m := &matcher{
-		index: make(map[langID]*matchHeader),
+		index:            make(map[language.Language]*matchHeader),
+		preferSameScript: true,
+	}
+	for _, o := range options {
+		o(m)
 	}
 	if len(supported) == 0 {
 		m.default_ = &haveTag{}
@@ -500,36 +380,41 @@ func newMatcher(supported []Tag) *matcher {
 	// Add supported languages to the index. Add exact matches first to give
 	// them precedence.
 	for i, tag := range supported {
-		pair, _ := makeHaveTag(tag, i)
-		m.header(tag.lang).addIfNew(pair, true)
-	}
-	m.default_ = m.header(supported[0].lang).exact[0]
+		tt := tag.tag()
+		pair, _ := makeHaveTag(tt, i)
+		m.header(tt.LangID).addIfNew(pair, true)
+		m.supported = append(m.supported, &pair)
+	}
+	m.default_ = m.header(supported[0].lang()).haveTags[0]
+	// Keep these in two different loops to support the case that two equivalent
+	// languages are distinguished, such as iw and he.
 	for i, tag := range supported {
-		pair, max := makeHaveTag(tag, i)
-		if max != tag.lang {
-			m.header(max).addIfNew(pair, false)
+		tt := tag.tag()
+		pair, max := makeHaveTag(tt, i)
+		if max != tt.LangID {
+			m.header(max).addIfNew(pair, true)
 		}
 	}
 
 	// update is used to add indexes in the map for equivalent languages.
-	// If force is true, the update will also apply to derived entries. To
-	// avoid applying a "transitive closure", use false.
-	update := func(want, have uint16, conf Confidence, force bool) {
-		if hh := m.index[langID(have)]; hh != nil {
-			if !force && len(hh.exact) == 0 {
+	// update will only add entries to original indexes, thus not computing any
+	// transitive relations.
+	update := func(want, have uint16, conf Confidence) {
+		if hh := m.index[language.Language(have)]; hh != nil {
+			if !hh.original {
 				return
 			}
-			hw := m.header(langID(want))
-			for _, ht := range hh.max {
+			hw := m.header(language.Language(want))
+			for _, ht := range hh.haveTags {
 				v := *ht
 				if conf < v.conf {
 					v.conf = conf
 				}
 				v.nextMax = 0 // this value needs to be recomputed
 				if v.altScript != 0 {
-					v.altScript = altScript(langID(want), v.maxScript)
+					v.altScript = altScript(language.Language(want), v.maxScript)
 				}
-				hw.addIfNew(v, conf == Exact && len(hh.exact) > 0)
+				hw.addIfNew(v, conf == Exact && hh.original)
 			}
 		}
 	}
@@ -537,9 +422,9 @@ func newMatcher(supported []Tag) *matcher {
 	// Add entries for languages with mutual intelligibility as defined by CLDR's
 	// languageMatch data.
 	for _, ml := range matchLang {
-		update(ml.want, ml.have, Confidence(ml.conf), false)
+		update(ml.want, ml.have, toConf(ml.distance))
 		if !ml.oneway {
-			update(ml.have, ml.want, Confidence(ml.conf), false)
+			update(ml.have, ml.want, toConf(ml.distance))
 		}
 	}
 
@@ -548,126 +433,157 @@ func newMatcher(supported []Tag) *matcher {
 	// First we match deprecated equivalents. If they are perfect equivalents
 	// (their canonicalization simply substitutes a different language code, but
 	// nothing else), the match confidence is Exact, otherwise it is High.
-	for i, lm := range langAliasMap {
-		if lm.from == _sh {
-			continue
-		}
-
+	for i, lm := range language.AliasMap {
 		// If deprecated codes match and there is no fiddling with the script or
 		// or region, we consider it an exact match.
 		conf := Exact
-		if langAliasTypes[i] != langMacro {
-			if !isExactEquivalent(langID(lm.from)) {
+		if language.AliasTypes[i] != language.Macro {
+			if !isExactEquivalent(language.Language(lm.From)) {
 				conf = High
 			}
-			update(lm.to, lm.from, conf, true)
+			update(lm.To, lm.From, conf)
 		}
-		update(lm.from, lm.to, conf, true)
+		update(lm.From, lm.To, conf)
 	}
 	return m
 }
 
 // getBest gets the best matching tag in m for any of the given tags, taking into
 // account the order of preference of the given tags.
-func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) {
+func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) {
 	best := bestMatch{}
-	for _, w := range want {
-		var max Tag
+	for i, ww := range want {
+		w := ww.tag()
+		var max language.Tag
 		// Check for exact match first.
-		h := m.index[w.lang]
-		if w.lang != 0 {
-			// Base language is defined.
+		h := m.index[w.LangID]
+		if w.LangID != 0 {
 			if h == nil {
 				continue
 			}
-			for i := range h.exact {
-				have := h.exact[i]
-				if have.tag.equalsRest(w) {
-					return have, w, Exact
-				}
+			// Base language is defined.
+			max, _ = canonicalize(Legacy|Deprecated|Macro, w)
+			// A region that is added through canonicalization is stronger than
+			// a maximized region: set it in the original (e.g. mo -> ro-MD).
+			if w.RegionID != max.RegionID {
+				w.RegionID = max.RegionID
 			}
-			max, _ = w.canonicalize(Legacy | Deprecated)
-			max, _ = addTags(max)
+			// TODO: should we do the same for scripts?
+			// See test case: en, sr, nl ; sh ; sr
+			max, _ = max.Maximize()
 		} else {
 			// Base language is not defined.
 			if h != nil {
-				for i := range h.exact {
-					have := h.exact[i]
-					if have.tag.equalsRest(w) {
+				for i := range h.haveTags {
+					have := h.haveTags[i]
+					if equalsRest(have.tag, w) {
 						return have, w, Exact
 					}
 				}
 			}
-			if w.script == 0 && w.region == 0 {
+			if w.ScriptID == 0 && w.RegionID == 0 {
 				// We skip all tags matching und for approximate matching, including
 				// private tags.
 				continue
 			}
-			max, _ = addTags(w)
-			if h = m.index[max.lang]; h == nil {
+			max, _ = w.Maximize()
+			if h = m.index[max.LangID]; h == nil {
 				continue
 			}
 		}
+		pin := true
+		for _, t := range want[i+1:] {
+			if w.LangID == t.lang() {
+				pin = false
+				break
+			}
+		}
 		// Check for match based on maximized tag.
-		for i := range h.max {
-			have := h.max[i]
-			best.update(have, w, max.script, max.region)
+		for i := range h.haveTags {
+			have := h.haveTags[i]
+			best.update(have, w, max.ScriptID, max.RegionID, pin)
 			if best.conf == Exact {
 				for have.nextMax != 0 {
-					have = h.max[have.nextMax]
-					best.update(have, w, max.script, max.region)
+					have = h.haveTags[have.nextMax]
+					best.update(have, w, max.ScriptID, max.RegionID, pin)
 				}
-				return best.have, best.want, High
+				return best.have, best.want, best.conf
 			}
 		}
 	}
 	if best.conf <= No {
 		if len(want) != 0 {
-			return nil, want[0], No
+			return nil, want[0].tag(), No
 		}
-		return nil, Tag{}, No
+		return nil, language.Tag{}, No
 	}
 	return best.have, best.want, best.conf
 }
 
 // bestMatch accumulates the best match so far.
 type bestMatch struct {
-	have *haveTag
-	want Tag
-	conf Confidence
+	have            *haveTag
+	want            language.Tag
+	conf            Confidence
+	pinnedRegion    language.Region
+	pinLanguage     bool
+	sameRegionGroup bool
 	// Cached results from applying tie-breaking rules.
-	origLang   bool
-	origReg    bool
-	regDist    uint8
-	origScript bool
-	parentDist uint8 // 255 if have is not an ancestor of want tag.
+	origLang     bool
+	origReg      bool
+	paradigmReg  bool
+	regGroupDist uint8
+	origScript   bool
 }
 
 // update updates the existing best match if the new pair is considered to be a
-// better match.
-// To determine if the given pair is a better match, it first computes the rough
-// confidence level. If this surpasses the current match, it will replace it and
-// update the tie-breaker rule cache. If there is a tie, it proceeds with applying
-// a series of tie-breaker rules. If there is no conclusive winner after applying
-// the tie-breaker rules, it leaves the current match as the preferred match.
-func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion regionID) {
+// better match. To determine if the given pair is a better match, it first
+// computes the rough confidence level. If this surpasses the current match, it
+// will replace it and update the tie-breaker rule cache. If there is a tie, it
+// proceeds with applying a series of tie-breaker rules. If there is no
+// conclusive winner after applying the tie-breaker rules, it leaves the current
+// match as the preferred match.
+//
+// If pin is true and have and tag are a strong match, it will henceforth only
+// consider matches for this language. This corresponds to the nothing that most
+// users have a strong preference for the first defined language. A user can
+// still prefer a second language over a dialect of the preferred language by
+// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should
+// be false.
+func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) {
 	// Bail if the maximum attainable confidence is below that of the current best match.
 	c := have.conf
 	if c < m.conf {
 		return
 	}
-	if have.maxScript != maxScript {
+	// Don't change the language once we already have found an exact match.
+	if m.pinLanguage && tag.LangID != m.want.LangID {
+		return
+	}
+	// Pin the region group if we are comparing tags for the same language.
+	if tag.LangID == m.want.LangID && m.sameRegionGroup {
+		_, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID)
+		if !sameGroup {
+			return
+		}
+	}
+	if c == Exact && have.maxScript == maxScript {
+		// If there is another language and then another entry of this language,
+		// don't pin anything, otherwise pin the language.
+		m.pinLanguage = pin
+	}
+	if equalsRest(have.tag, tag) {
+	} else if have.maxScript != maxScript {
 		// There is usually very little comprehension between different scripts.
-		// In a few cases there may still be Low comprehension. This possibility is
-		// pre-computed and stored in have.altScript.
+		// In a few cases there may still be Low comprehension. This possibility
+		// is pre-computed and stored in have.altScript.
 		if Low < m.conf || have.altScript != maxScript {
 			return
 		}
 		c = Low
 	} else if have.maxRegion != maxRegion {
-		// There is usually a small difference between languages across regions.
-		// We use the region distance (below) to disambiguate between equal matches.
 		if High < c {
+			// There is usually a small difference between languages across regions.
 			c = High
 		}
 	}
@@ -686,7 +602,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion
 
 	// Tie-breaker rules:
 	// We prefer if the pre-maximized language was specified and identical.
-	origLang := have.tag.lang == tag.lang && tag.lang != 0
+	origLang := have.tag.LangID == tag.LangID && tag.LangID != 0
 	if !beaten && m.origLang != origLang {
 		if m.origLang {
 			return
@@ -695,7 +611,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion
 	}
 
 	// We prefer if the pre-maximized region was specified and identical.
-	origReg := have.tag.region == tag.region && tag.region != 0
+	origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0
 	if !beaten && m.origReg != origReg {
 		if m.origReg {
 			return
@@ -703,28 +619,26 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion
 		beaten = true
 	}
 
-	// Next we prefer smaller distances between regions, as defined by regionDist.
-	regDist := regionDist(have.maxRegion, maxRegion, tag.lang)
-	if !beaten && m.regDist != regDist {
-		if regDist > m.regDist {
+	regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID)
+	if !beaten && m.regGroupDist != regGroupDist {
+		if regGroupDist > m.regGroupDist {
 			return
 		}
 		beaten = true
 	}
 
-	// Next we prefer if the pre-maximized script was specified and identical.
-	origScript := have.tag.script == tag.script && tag.script != 0
-	if !beaten && m.origScript != origScript {
-		if m.origScript {
+	paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion)
+	if !beaten && m.paradigmReg != paradigmReg {
+		if !paradigmReg {
 			return
 		}
 		beaten = true
 	}
 
-	// Finally we prefer tags which have a closer parent relationship.
-	parentDist := parentDistance(have.tag.region, tag)
-	if !beaten && m.parentDist != parentDist {
-		if parentDist > m.parentDist {
+	// Next we prefer if the pre-maximized script was specified and identical.
+	origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0
+	if !beaten && m.origScript != origScript {
+		if m.origScript {
 			return
 		}
 		beaten = true
@@ -735,90 +649,59 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion
 		m.have = have
 		m.want = tag
 		m.conf = c
+		m.pinnedRegion = maxRegion
+		m.sameRegionGroup = sameGroup
 		m.origLang = origLang
 		m.origReg = origReg
+		m.paradigmReg = paradigmReg
 		m.origScript = origScript
-		m.regDist = regDist
-		m.parentDist = parentDist
+		m.regGroupDist = regGroupDist
 	}
 }
 
-// parentDistance returns the number of times Parent must be called before the
-// regions match. It is assumed that it has already been checked that lang and
-// script are identical. If haveRegion does not occur in the ancestor chain of
-// tag, it returns 255.
-func parentDistance(haveRegion regionID, tag Tag) uint8 {
-	p := tag.Parent()
-	d := uint8(1)
-	for haveRegion != p.region {
-		if p.region == 0 {
-			return 255
+func isParadigmLocale(lang language.Language, r language.Region) bool {
+	for _, e := range paradigmLocales {
+		if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) {
+			return true
 		}
-		p = p.Parent()
-		d++
-	}
-	return d
-}
-
-// regionDist wraps regionDistance with some exceptions to the algorithmic distance.
-func regionDist(a, b regionID, lang langID) uint8 {
-	if lang == _en {
-		// Two variants of non-US English are close to each other, regardless of distance.
-		if a != _US && b != _US {
-			return 2
-		}
-	}
-	return uint8(regionDistance(a, b))
-}
-
-// regionDistance computes the distance between two regions based on the
-// distance in the graph of region containments as defined in CLDR. It iterates
-// over increasingly inclusive sets of groups, represented as bit vectors, until
-// the source bit vector has bits in common with the destination vector.
-func regionDistance(a, b regionID) int {
-	if a == b {
-		return 0
-	}
-	p, q := regionInclusion[a], regionInclusion[b]
-	if p < nRegionGroups {
-		p, q = q, p
-	}
-	set := regionInclusionBits
-	if q < nRegionGroups && set[p]&(1<<q) != 0 {
-		return 1
-	}
-	d := 2
-	for goal := set[q]; set[p]&goal == 0; p = regionInclusionNext[p] {
-		d++
 	}
-	return d
+	return false
 }
 
-func (t Tag) variants() string {
-	if t.pVariant == 0 {
-		return ""
-	}
-	return t.str[t.pVariant:t.pExt]
-}
+// regionGroupDist computes the distance between two regions based on their
+// CLDR grouping.
+func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) {
+	const defaultDistance = 4
 
-// variantOrPrivateTagStr returns variants or private use tags.
-func (t Tag) variantOrPrivateTagStr() string {
-	if t.pExt > 0 {
-		return t.str[t.pVariant:t.pExt]
+	aGroup := uint(regionToGroups[a]) << 1
+	bGroup := uint(regionToGroups[b]) << 1
+	for _, ri := range matchRegion {
+		if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) {
+			group := uint(1 << (ri.group &^ 0x80))
+			if 0x80&ri.group == 0 {
+				if aGroup&bGroup&group != 0 { // Both regions are in the group.
+					return ri.distance, ri.distance == defaultDistance
+				}
+			} else {
+				if (aGroup|bGroup)&group == 0 { // Both regions are not in the group.
+					return ri.distance, ri.distance == defaultDistance
+				}
+			}
+		}
 	}
-	return t.str[t.pVariant:]
+	return defaultDistance, true
 }
 
 // equalsRest compares everything except the language.
-func (a Tag) equalsRest(b Tag) bool {
+func equalsRest(a, b language.Tag) bool {
 	// TODO: don't include extensions in this comparison. To do this efficiently,
 	// though, we should handle private tags separately.
-	return a.script == b.script && a.region == b.region && a.variantOrPrivateTagStr() == b.variantOrPrivateTagStr()
+	return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags()
 }
 
 // isExactEquivalent returns true if canonicalizing the language will not alter
 // the script or region of a tag.
-func isExactEquivalent(l langID) bool {
+func isExactEquivalent(l language.Language) bool {
 	for _, o := range notEquivalent {
 		if o == l {
 			return false
@@ -827,15 +710,26 @@ func isExactEquivalent(l langID) bool {
 	return true
 }
 
-var notEquivalent []langID
+var notEquivalent []language.Language
 
 func init() {
 	// Create a list of all languages for which canonicalization may alter the
 	// script or region.
-	for _, lm := range langAliasMap {
-		tag := Tag{lang: langID(lm.from)}
-		if tag, _ = tag.canonicalize(All); tag.script != 0 || tag.region != 0 {
-			notEquivalent = append(notEquivalent, langID(lm.from))
+	for _, lm := range language.AliasMap {
+		tag := language.Tag{LangID: language.Language(lm.From)}
+		if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 {
+			notEquivalent = append(notEquivalent, language.Language(lm.From))
+		}
+	}
+	// Maximize undefined regions of paradigm locales.
+	for i, v := range paradigmLocales {
+		t := language.Tag{LangID: language.Language(v[0])}
+		max, _ := t.Maximize()
+		if v[1] == 0 {
+			paradigmLocales[i][1] = uint16(max.RegionID)
+		}
+		if v[2] == 0 {
+			paradigmLocales[i][2] = uint16(max.RegionID)
 		}
 	}
 }
diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go
index cfa28f56e..11acfd885 100644
--- a/vendor/golang.org/x/text/language/parse.go
+++ b/vendor/golang.org/x/text/language/parse.go
@@ -5,216 +5,21 @@
 package language
 
 import (
-	"bytes"
 	"errors"
-	"fmt"
-	"sort"
 	"strconv"
 	"strings"
 
-	"golang.org/x/text/internal/tag"
+	"golang.org/x/text/internal/language"
 )
 
-// isAlpha returns true if the byte is not a digit.
-// b must be an ASCII letter or digit.
-func isAlpha(b byte) bool {
-	return b > '9'
-}
-
-// isAlphaNum returns true if the string contains only ASCII letters or digits.
-func isAlphaNum(s []byte) bool {
-	for _, c := range s {
-		if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
-			return false
-		}
-	}
-	return true
-}
-
-// errSyntax is returned by any of the parsing functions when the
-// input is not well-formed, according to BCP 47.
-// TODO: return the position at which the syntax error occurred?
-var errSyntax = errors.New("language: tag is not well-formed")
-
 // ValueError is returned by any of the parsing functions when the
 // input is well-formed but the respective subtag is not recognized
 // as a valid value.
-type ValueError struct {
-	v [8]byte
-}
-
-func mkErrInvalid(s []byte) error {
-	var e ValueError
-	copy(e.v[:], s)
-	return e
-}
-
-func (e ValueError) tag() []byte {
-	n := bytes.IndexByte(e.v[:], 0)
-	if n == -1 {
-		n = 8
-	}
-	return e.v[:n]
-}
-
-// Error implements the error interface.
-func (e ValueError) Error() string {
-	return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
-}
-
-// Subtag returns the subtag for which the error occurred.
-func (e ValueError) Subtag() string {
-	return string(e.tag())
-}
-
-// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
-type scanner struct {
-	b     []byte
-	bytes [max99thPercentileSize]byte
-	token []byte
-	start int // start position of the current token
-	end   int // end position of the current token
-	next  int // next point for scan
-	err   error
-	done  bool
-}
-
-func makeScannerString(s string) scanner {
-	scan := scanner{}
-	if len(s) <= len(scan.bytes) {
-		scan.b = scan.bytes[:copy(scan.bytes[:], s)]
-	} else {
-		scan.b = []byte(s)
-	}
-	scan.init()
-	return scan
-}
-
-// makeScanner returns a scanner using b as the input buffer.
-// b is not copied and may be modified by the scanner routines.
-func makeScanner(b []byte) scanner {
-	scan := scanner{b: b}
-	scan.init()
-	return scan
-}
-
-func (s *scanner) init() {
-	for i, c := range s.b {
-		if c == '_' {
-			s.b[i] = '-'
-		}
-	}
-	s.scan()
-}
-
-// restToLower converts the string between start and end to lower case.
-func (s *scanner) toLower(start, end int) {
-	for i := start; i < end; i++ {
-		c := s.b[i]
-		if 'A' <= c && c <= 'Z' {
-			s.b[i] += 'a' - 'A'
-		}
-	}
-}
+type ValueError interface {
+	error
 
-func (s *scanner) setError(e error) {
-	if s.err == nil || (e == errSyntax && s.err != errSyntax) {
-		s.err = e
-	}
-}
-
-// resizeRange shrinks or grows the array at position oldStart such that
-// a new string of size newSize can fit between oldStart and oldEnd.
-// Sets the scan point to after the resized range.
-func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
-	s.start = oldStart
-	if end := oldStart + newSize; end != oldEnd {
-		diff := end - oldEnd
-		if end < cap(s.b) {
-			b := make([]byte, len(s.b)+diff)
-			copy(b, s.b[:oldStart])
-			copy(b[end:], s.b[oldEnd:])
-			s.b = b
-		} else {
-			s.b = append(s.b[end:], s.b[oldEnd:]...)
-		}
-		s.next = end + (s.next - s.end)
-		s.end = end
-	}
-}
-
-// replace replaces the current token with repl.
-func (s *scanner) replace(repl string) {
-	s.resizeRange(s.start, s.end, len(repl))
-	copy(s.b[s.start:], repl)
-}
-
-// gobble removes the current token from the input.
-// Caller must call scan after calling gobble.
-func (s *scanner) gobble(e error) {
-	s.setError(e)
-	if s.start == 0 {
-		s.b = s.b[:+copy(s.b, s.b[s.next:])]
-		s.end = 0
-	} else {
-		s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
-		s.end = s.start - 1
-	}
-	s.next = s.start
-}
-
-// deleteRange removes the given range from s.b before the current token.
-func (s *scanner) deleteRange(start, end int) {
-	s.setError(errSyntax)
-	s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
-	diff := end - start
-	s.next -= diff
-	s.start -= diff
-	s.end -= diff
-}
-
-// scan parses the next token of a BCP 47 string.  Tokens that are larger
-// than 8 characters or include non-alphanumeric characters result in an error
-// and are gobbled and removed from the output.
-// It returns the end position of the last token consumed.
-func (s *scanner) scan() (end int) {
-	end = s.end
-	s.token = nil
-	for s.start = s.next; s.next < len(s.b); {
-		i := bytes.IndexByte(s.b[s.next:], '-')
-		if i == -1 {
-			s.end = len(s.b)
-			s.next = len(s.b)
-			i = s.end - s.start
-		} else {
-			s.end = s.next + i
-			s.next = s.end + 1
-		}
-		token := s.b[s.start:s.end]
-		if i < 1 || i > 8 || !isAlphaNum(token) {
-			s.gobble(errSyntax)
-			continue
-		}
-		s.token = token
-		return end
-	}
-	if n := len(s.b); n > 0 && s.b[n-1] == '-' {
-		s.setError(errSyntax)
-		s.b = s.b[:len(s.b)-1]
-	}
-	s.done = true
-	return end
-}
-
-// acceptMinSize parses multiple tokens of the given size or greater.
-// It returns the end position of the last token consumed.
-func (s *scanner) acceptMinSize(min int) (end int) {
-	end = s.end
-	s.scan()
-	for ; len(s.token) >= min; s.scan() {
-		end = s.end
-	}
-	return end
+	// Subtag returns the subtag for which the error occurred.
+	Subtag() string
 }
 
 // Parse parses the given BCP 47 string and returns a valid Tag. If parsing
@@ -223,7 +28,7 @@ func (s *scanner) acceptMinSize(min int) (end int) {
 // ValueError. The Tag returned in this case is just stripped of the unknown
 // value. All other values are preserved. It accepts tags in the BCP 47 format
 // and extensions to this standard defined in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
 // The resulting tag is canonicalized using the default canonicalization type.
 func Parse(s string) (t Tag, err error) {
 	return Default.Parse(s)
@@ -235,327 +40,18 @@ func Parse(s string) (t Tag, err error) {
 // ValueError. The Tag returned in this case is just stripped of the unknown
 // value. All other values are preserved. It accepts tags in the BCP 47 format
 // and extensions to this standard defined in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-// The resulting tag is canonicalized using the the canonicalization type c.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// The resulting tag is canonicalized using the canonicalization type c.
 func (c CanonType) Parse(s string) (t Tag, err error) {
-	// TODO: consider supporting old-style locale key-value pairs.
-	if s == "" {
-		return und, errSyntax
-	}
-	if len(s) <= maxAltTaglen {
-		b := [maxAltTaglen]byte{}
-		for i, c := range s {
-			// Generating invalid UTF-8 is okay as it won't match.
-			if 'A' <= c && c <= 'Z' {
-				c += 'a' - 'A'
-			} else if c == '_' {
-				c = '-'
-			}
-			b[i] = byte(c)
-		}
-		if t, ok := grandfathered(b); ok {
-			return t, nil
-		}
+	tt, err := language.Parse(s)
+	if err != nil {
+		return makeTag(tt), err
 	}
-	scan := makeScannerString(s)
-	t, err = parse(&scan, s)
-	t, changed := t.canonicalize(c)
+	tt, changed := canonicalize(c, tt)
 	if changed {
-		t.remakeString()
-	}
-	return t, err
-}
-
-func parse(scan *scanner, s string) (t Tag, err error) {
-	t = und
-	var end int
-	if n := len(scan.token); n <= 1 {
-		scan.toLower(0, len(scan.b))
-		if n == 0 || scan.token[0] != 'x' {
-			return t, errSyntax
-		}
-		end = parseExtensions(scan)
-	} else if n >= 4 {
-		return und, errSyntax
-	} else { // the usual case
-		t, end = parseTag(scan)
-		if n := len(scan.token); n == 1 {
-			t.pExt = uint16(end)
-			end = parseExtensions(scan)
-		} else if end < len(scan.b) {
-			scan.setError(errSyntax)
-			scan.b = scan.b[:end]
-		}
-	}
-	if int(t.pVariant) < len(scan.b) {
-		if end < len(s) {
-			s = s[:end]
-		}
-		if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
-			t.str = s
-		} else {
-			t.str = string(scan.b)
-		}
-	} else {
-		t.pVariant, t.pExt = 0, 0
-	}
-	return t, scan.err
-}
-
-// parseTag parses language, script, region and variants.
-// It returns a Tag and the end position in the input that was parsed.
-func parseTag(scan *scanner) (t Tag, end int) {
-	var e error
-	// TODO: set an error if an unknown lang, script or region is encountered.
-	t.lang, e = getLangID(scan.token)
-	scan.setError(e)
-	scan.replace(t.lang.String())
-	langStart := scan.start
-	end = scan.scan()
-	for len(scan.token) == 3 && isAlpha(scan.token[0]) {
-		// From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
-		// to a tag of the form <extlang>.
-		lang, e := getLangID(scan.token)
-		if lang != 0 {
-			t.lang = lang
-			copy(scan.b[langStart:], lang.String())
-			scan.b[langStart+3] = '-'
-			scan.start = langStart + 4
-		}
-		scan.gobble(e)
-		end = scan.scan()
-	}
-	if len(scan.token) == 4 && isAlpha(scan.token[0]) {
-		t.script, e = getScriptID(script, scan.token)
-		if t.script == 0 {
-			scan.gobble(e)
-		}
-		end = scan.scan()
-	}
-	if n := len(scan.token); n >= 2 && n <= 3 {
-		t.region, e = getRegionID(scan.token)
-		if t.region == 0 {
-			scan.gobble(e)
-		} else {
-			scan.replace(t.region.String())
-		}
-		end = scan.scan()
-	}
-	scan.toLower(scan.start, len(scan.b))
-	t.pVariant = byte(end)
-	end = parseVariants(scan, end, t)
-	t.pExt = uint16(end)
-	return t, end
-}
-
-var separator = []byte{'-'}
-
-// parseVariants scans tokens as long as each token is a valid variant string.
-// Duplicate variants are removed.
-func parseVariants(scan *scanner, end int, t Tag) int {
-	start := scan.start
-	varIDBuf := [4]uint8{}
-	variantBuf := [4][]byte{}
-	varID := varIDBuf[:0]
-	variant := variantBuf[:0]
-	last := -1
-	needSort := false
-	for ; len(scan.token) >= 4; scan.scan() {
-		// TODO: measure the impact of needing this conversion and redesign
-		// the data structure if there is an issue.
-		v, ok := variantIndex[string(scan.token)]
-		if !ok {
-			// unknown variant
-			// TODO: allow user-defined variants?
-			scan.gobble(mkErrInvalid(scan.token))
-			continue
-		}
-		varID = append(varID, v)
-		variant = append(variant, scan.token)
-		if !needSort {
-			if last < int(v) {
-				last = int(v)
-			} else {
-				needSort = true
-				// There is no legal combinations of more than 7 variants
-				// (and this is by no means a useful sequence).
-				const maxVariants = 8
-				if len(varID) > maxVariants {
-					break
-				}
-			}
-		}
-		end = scan.end
-	}
-	if needSort {
-		sort.Sort(variantsSort{varID, variant})
-		k, l := 0, -1
-		for i, v := range varID {
-			w := int(v)
-			if l == w {
-				// Remove duplicates.
-				continue
-			}
-			varID[k] = varID[i]
-			variant[k] = variant[i]
-			k++
-			l = w
-		}
-		if str := bytes.Join(variant[:k], separator); len(str) == 0 {
-			end = start - 1
-		} else {
-			scan.resizeRange(start, end, len(str))
-			copy(scan.b[scan.start:], str)
-			end = scan.end
-		}
-	}
-	return end
-}
-
-type variantsSort struct {
-	i []uint8
-	v [][]byte
-}
-
-func (s variantsSort) Len() int {
-	return len(s.i)
-}
-
-func (s variantsSort) Swap(i, j int) {
-	s.i[i], s.i[j] = s.i[j], s.i[i]
-	s.v[i], s.v[j] = s.v[j], s.v[i]
-}
-
-func (s variantsSort) Less(i, j int) bool {
-	return s.i[i] < s.i[j]
-}
-
-type bytesSort [][]byte
-
-func (b bytesSort) Len() int {
-	return len(b)
-}
-
-func (b bytesSort) Swap(i, j int) {
-	b[i], b[j] = b[j], b[i]
-}
-
-func (b bytesSort) Less(i, j int) bool {
-	return bytes.Compare(b[i], b[j]) == -1
-}
-
-// parseExtensions parses and normalizes the extensions in the buffer.
-// It returns the last position of scan.b that is part of any extension.
-// It also trims scan.b to remove excess parts accordingly.
-func parseExtensions(scan *scanner) int {
-	start := scan.start
-	exts := [][]byte{}
-	private := []byte{}
-	end := scan.end
-	for len(scan.token) == 1 {
-		extStart := scan.start
-		ext := scan.token[0]
-		end = parseExtension(scan)
-		extension := scan.b[extStart:end]
-		if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
-			scan.setError(errSyntax)
-			end = extStart
-			continue
-		} else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
-			scan.b = scan.b[:end]
-			return end
-		} else if ext == 'x' {
-			private = extension
-			break
-		}
-		exts = append(exts, extension)
+		tt.RemakeString()
 	}
-	sort.Sort(bytesSort(exts))
-	if len(private) > 0 {
-		exts = append(exts, private)
-	}
-	scan.b = scan.b[:start]
-	if len(exts) > 0 {
-		scan.b = append(scan.b, bytes.Join(exts, separator)...)
-	} else if start > 0 {
-		// Strip trailing '-'.
-		scan.b = scan.b[:start-1]
-	}
-	return end
-}
-
-// parseExtension parses a single extension and returns the position of
-// the extension end.
-func parseExtension(scan *scanner) int {
-	start, end := scan.start, scan.end
-	switch scan.token[0] {
-	case 'u':
-		attrStart := end
-		scan.scan()
-		for last := []byte{}; len(scan.token) > 2; scan.scan() {
-			if bytes.Compare(scan.token, last) != -1 {
-				// Attributes are unsorted. Start over from scratch.
-				p := attrStart + 1
-				scan.next = p
-				attrs := [][]byte{}
-				for scan.scan(); len(scan.token) > 2; scan.scan() {
-					attrs = append(attrs, scan.token)
-					end = scan.end
-				}
-				sort.Sort(bytesSort(attrs))
-				copy(scan.b[p:], bytes.Join(attrs, separator))
-				break
-			}
-			last = scan.token
-			end = scan.end
-		}
-		var last, key []byte
-		for attrEnd := end; len(scan.token) == 2; last = key {
-			key = scan.token
-			keyEnd := scan.end
-			end = scan.acceptMinSize(3)
-			// TODO: check key value validity
-			if keyEnd == end || bytes.Compare(key, last) != 1 {
-				// We have an invalid key or the keys are not sorted.
-				// Start scanning keys from scratch and reorder.
-				p := attrEnd + 1
-				scan.next = p
-				keys := [][]byte{}
-				for scan.scan(); len(scan.token) == 2; {
-					keyStart, keyEnd := scan.start, scan.end
-					end = scan.acceptMinSize(3)
-					if keyEnd != end {
-						keys = append(keys, scan.b[keyStart:end])
-					} else {
-						scan.setError(errSyntax)
-						end = keyStart
-					}
-				}
-				sort.Sort(bytesSort(keys))
-				reordered := bytes.Join(keys, separator)
-				if e := p + len(reordered); e < end {
-					scan.deleteRange(e, end)
-					end = e
-				}
-				copy(scan.b[p:], bytes.Join(keys, separator))
-				break
-			}
-		}
-	case 't':
-		scan.scan()
-		if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
-			_, end = parseTag(scan)
-			scan.toLower(start, end)
-		}
-		for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
-			end = scan.acceptMinSize(3)
-		}
-	case 'x':
-		end = scan.acceptMinSize(1)
-	default:
-		end = scan.acceptMinSize(2)
-	}
-	return end
+	return makeTag(tt), err
 }
 
 // Compose creates a Tag from individual parts, which may be of type Tag, Base,
@@ -563,10 +59,11 @@ func parseExtension(scan *scanner) int {
 // Base, Script or Region or slice of type Variant or Extension is passed more
 // than once, the latter will overwrite the former. Variants and Extensions are
 // accumulated, but if two extensions of the same type are passed, the latter
-// will replace the former. A Tag overwrites all former values and typically
-// only makes sense as the first argument. The resulting tag is returned after
-// canonicalizing using the Default CanonType. If one or more errors are
-// encountered, one of the errors is returned.
+// will replace the former. For -u extensions, though, the key-type pairs are
+// added, where later values overwrite older ones. A Tag overwrites all former
+// values and typically only makes sense as the first argument. The resulting
+// tag is returned after canonicalizing using the Default CanonType. If one or
+// more errors are encountered, one of the errors is returned.
 func Compose(part ...interface{}) (t Tag, err error) {
 	return Default.Compose(part...)
 }
@@ -576,196 +73,68 @@ func Compose(part ...interface{}) (t Tag, err error) {
 // Base, Script or Region or slice of type Variant or Extension is passed more
 // than once, the latter will overwrite the former. Variants and Extensions are
 // accumulated, but if two extensions of the same type are passed, the latter
-// will replace the former. A Tag overwrites all former values and typically
-// only makes sense as the first argument. The resulting tag is returned after
-// canonicalizing using CanonType c. If one or more errors are encountered,
-// one of the errors is returned.
+// will replace the former. For -u extensions, though, the key-type pairs are
+// added, where later values overwrite older ones. A Tag overwrites all former
+// values and typically only makes sense as the first argument. The resulting
+// tag is returned after canonicalizing using CanonType c. If one or more errors
+// are encountered, one of the errors is returned.
 func (c CanonType) Compose(part ...interface{}) (t Tag, err error) {
-	var b builder
-	if err = b.update(part...); err != nil {
+	var b language.Builder
+	if err = update(&b, part...); err != nil {
 		return und, err
 	}
-	t, _ = b.tag.canonicalize(c)
-
-	if len(b.ext) > 0 || len(b.variant) > 0 {
-		sort.Sort(sortVariant(b.variant))
-		sort.Strings(b.ext)
-		if b.private != "" {
-			b.ext = append(b.ext, b.private)
-		}
-		n := maxCoreSize + tokenLen(b.variant...) + tokenLen(b.ext...)
-		buf := make([]byte, n)
-		p := t.genCoreBytes(buf)
-		t.pVariant = byte(p)
-		p += appendTokens(buf[p:], b.variant...)
-		t.pExt = uint16(p)
-		p += appendTokens(buf[p:], b.ext...)
-		t.str = string(buf[:p])
-	} else if b.private != "" {
-		t.str = b.private
-		t.remakeString()
-	}
-	return
-}
-
-type builder struct {
-	tag Tag
-
-	private string // the x extension
-	ext     []string
-	variant []string
-
-	err error
-}
-
-func (b *builder) addExt(e string) {
-	if e == "" {
-	} else if e[0] == 'x' {
-		b.private = e
-	} else {
-		b.ext = append(b.ext, e)
-	}
+	b.Tag, _ = canonicalize(c, b.Tag)
+	return makeTag(b.Make()), err
 }
 
 var errInvalidArgument = errors.New("invalid Extension or Variant")
 
-func (b *builder) update(part ...interface{}) (err error) {
-	replace := func(l *[]string, s string, eq func(a, b string) bool) bool {
-		if s == "" {
-			b.err = errInvalidArgument
-			return true
-		}
-		for i, v := range *l {
-			if eq(v, s) {
-				(*l)[i] = s
-				return true
-			}
-		}
-		return false
-	}
+func update(b *language.Builder, part ...interface{}) (err error) {
 	for _, x := range part {
 		switch v := x.(type) {
 		case Tag:
-			b.tag.lang = v.lang
-			b.tag.region = v.region
-			b.tag.script = v.script
-			if v.str != "" {
-				b.variant = nil
-				for x, s := "", v.str[v.pVariant:v.pExt]; s != ""; {
-					x, s = nextToken(s)
-					b.variant = append(b.variant, x)
-				}
-				b.ext, b.private = nil, ""
-				for i, e := int(v.pExt), ""; i < len(v.str); {
-					i, e = getExtension(v.str, i)
-					b.addExt(e)
-				}
-			}
+			b.SetTag(v.tag())
 		case Base:
-			b.tag.lang = v.langID
+			b.Tag.LangID = v.langID
 		case Script:
-			b.tag.script = v.scriptID
+			b.Tag.ScriptID = v.scriptID
 		case Region:
-			b.tag.region = v.regionID
+			b.Tag.RegionID = v.regionID
 		case Variant:
-			if !replace(&b.variant, v.variant, func(a, b string) bool { return a == b }) {
-				b.variant = append(b.variant, v.variant)
+			if v.variant == "" {
+				err = errInvalidArgument
+				break
 			}
+			b.AddVariant(v.variant)
 		case Extension:
-			if !replace(&b.ext, v.s, func(a, b string) bool { return a[0] == b[0] }) {
-				b.addExt(v.s)
+			if v.s == "" {
+				err = errInvalidArgument
+				break
 			}
+			b.SetExt(v.s)
 		case []Variant:
-			b.variant = nil
-			for _, x := range v {
-				b.update(x)
+			b.ClearVariants()
+			for _, v := range v {
+				b.AddVariant(v.variant)
 			}
 		case []Extension:
-			b.ext, b.private = nil, ""
+			b.ClearExtensions()
 			for _, e := range v {
-				b.update(e)
+				b.SetExt(e.s)
 			}
 		// TODO: support parsing of raw strings based on morphology or just extensions?
 		case error:
-			err = v
-		}
-	}
-	return
-}
-
-func tokenLen(token ...string) (n int) {
-	for _, t := range token {
-		n += len(t) + 1
-	}
-	return
-}
-
-func appendTokens(b []byte, token ...string) int {
-	p := 0
-	for _, t := range token {
-		b[p] = '-'
-		copy(b[p+1:], t)
-		p += 1 + len(t)
-	}
-	return p
-}
-
-type sortVariant []string
-
-func (s sortVariant) Len() int {
-	return len(s)
-}
-
-func (s sortVariant) Swap(i, j int) {
-	s[j], s[i] = s[i], s[j]
-}
-
-func (s sortVariant) Less(i, j int) bool {
-	return variantIndex[s[i]] < variantIndex[s[j]]
-}
-
-func findExt(list []string, x byte) int {
-	for i, e := range list {
-		if e[0] == x {
-			return i
-		}
-	}
-	return -1
-}
-
-// getExtension returns the name, body and end position of the extension.
-func getExtension(s string, p int) (end int, ext string) {
-	if s[p] == '-' {
-		p++
-	}
-	if s[p] == 'x' {
-		return len(s), s[p:]
-	}
-	end = nextExtension(s, p)
-	return end, s[p:end]
-}
-
-// nextExtension finds the next extension within the string, searching
-// for the -<char>- pattern from position p.
-// In the fast majority of cases, language tags will have at most
-// one extension and extensions tend to be small.
-func nextExtension(s string, p int) int {
-	for n := len(s) - 3; p < n; {
-		if s[p] == '-' {
-			if s[p+2] == '-' {
-				return p
+			if v != nil {
+				err = v
 			}
-			p += 3
-		} else {
-			p++
 		}
 	}
-	return len(s)
+	return
 }
 
 var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight")
 
-// ParseAcceptLanguage parses the contents of a Accept-Language header as
+// ParseAcceptLanguage parses the contents of an Accept-Language header as
 // defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and
 // a list of corresponding quality weights. It is more permissive than RFC 2616
 // and may return non-nil slices even if the input is not valid.
@@ -788,7 +157,7 @@ func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) {
 			if !ok {
 				return nil, nil, err
 			}
-			t = Tag{lang: id}
+			t = makeTag(language.Tag{LangID: id})
 		}
 
 		// Scan the optional weight.
@@ -830,9 +199,9 @@ func split(s string, c byte) (head, tail string) {
 	return strings.TrimSpace(s), ""
 }
 
-// Add hack mapping to deal with a small number of cases that that occur
+// Add hack mapping to deal with a small number of cases that occur
 // in Accept-Language (with reasonable frequency).
-var acceptFallback = map[string]langID{
+var acceptFallback = map[string]language.Language{
 	"english": _en,
 	"deutsch": _de,
 	"italian": _it,
diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go
index ccdc1ff0f..e22807719 100644
--- a/vendor/golang.org/x/text/language/tables.go
+++ b/vendor/golang.org/x/text/language/tables.go
@@ -1,3547 +1,298 @@
-// This file was generated by go generate; DO NOT EDIT
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
 
 package language
 
-import "golang.org/x/text/internal/tag"
-
 // CLDRVersion is the CLDR version from which the tables in this package are derived.
-const CLDRVersion = "30"
-
-const numLanguages = 8654
-
-const numScripts = 230
-
-const numRegions = 356
-
-type fromTo struct {
-	from uint16
-	to   uint16
-}
+const CLDRVersion = "32"
 
-const nonCanonicalUnd = 1191
 const (
-	_af  = 21
-	_am  = 38
-	_ar  = 57
-	_az  = 87
-	_bg  = 125
-	_bn  = 163
-	_ca  = 213
-	_cs  = 246
-	_da  = 253
-	_de  = 265
-	_el  = 305
-	_en  = 308
-	_es  = 313
-	_et  = 315
-	_fa  = 323
-	_fi  = 332
-	_fil = 334
-	_fr  = 345
-	_gu  = 413
-	_he  = 437
-	_hi  = 439
-	_hr  = 458
-	_hu  = 462
-	_hy  = 464
-	_id  = 474
-	_is  = 496
-	_it  = 497
-	_ja  = 504
-	_ka  = 520
-	_kk  = 570
-	_km  = 578
-	_kn  = 585
-	_ko  = 587
-	_ky  = 641
-	_lo  = 687
-	_lt  = 695
-	_lv  = 702
-	_mk  = 758
-	_ml  = 763
-	_mn  = 770
-	_mo  = 775
-	_mr  = 786
-	_ms  = 790
-	_mul = 797
-	_my  = 808
-	_nb  = 830
-	_ne  = 840
-	_nl  = 862
-	_no  = 870
-	_pa  = 916
-	_pl  = 938
-	_pt  = 951
-	_ro  = 979
-	_ru  = 985
-	_sh  = 1021
-	_si  = 1026
-	_sk  = 1032
-	_sl  = 1036
-	_sq  = 1063
-	_sr  = 1064
-	_sv  = 1082
-	_sw  = 1083
-	_ta  = 1094
-	_te  = 1111
-	_th  = 1121
-	_tl  = 1136
-	_tn  = 1142
-	_tr  = 1152
-	_uk  = 1188
-	_ur  = 1194
-	_uz  = 1202
-	_vi  = 1209
-	_zh  = 1311
-	_zu  = 1316
-	_jbo = 507
-	_ami = 1639
-	_bnn = 2346
-	_hak = 431
-	_tlh = 14456
-	_lb  = 652
-	_nv  = 890
-	_pwn = 12044
-	_tao = 14177
-	_tay = 14187
-	_tsu = 14651
-	_nn  = 865
-	_sfb = 13618
-	_vgt = 15690
-	_sgg = 13649
-	_cmn = 2996
-	_nan = 826
-	_hsn = 460
+	_de  = 269
+	_en  = 313
+	_fr  = 350
+	_it  = 505
+	_mo  = 784
+	_no  = 879
+	_nb  = 839
+	_pt  = 960
+	_sh  = 1031
+	_mul = 806
+	_und = 0
+)
+const (
+	_001 = 1
+	_419 = 31
+	_BR  = 65
+	_CA  = 73
+	_ES  = 110
+	_GB  = 123
+	_MD  = 188
+	_PT  = 238
+	_UK  = 306
+	_US  = 309
+	_ZZ  = 357
+	_XA  = 323
+	_XC  = 325
+	_XK  = 333
 )
-
-const langPrivateStart = 0x2f67
-
-const langPrivateEnd = 0x316e
-
-// lang holds an alphabetically sorted list of ISO-639 language identifiers.
-// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
-// For 2-byte language identifiers, the two successive bytes have the following meaning:
-//     - if the first letter of the 2- and 3-letter ISO codes are the same:
-//       the second and third letter of the 3-letter ISO code.
-//     - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
-// For 3-byte language identifiers the 4th byte is 0.
-const lang tag.Index = "" + // Size: 5280 bytes
-	"---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abr\x00abt\x00aby\x00acd\x00a" +
-	"ce\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey\x00affrag" +
-	"c\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00ajg\x00akka" +
-	"akk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00amp\x00anrga" +
-	"nc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00ape\x00apr" +
-	"\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars\x00ary\x00a" +
-	"rz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00atj\x00auy" +
-	"\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx\x00ayymayb" +
-	"\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00bba\x00bbb" +
-	"\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bcm\x00bcn" +
-	"\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00bet\x00b" +
-	"ew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn\x00bgx" +
-	"\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib\x00big" +
-	"\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn\x00bjo" +
-	"\x00bjr\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt\x00bmambmh\x00b" +
-	"mk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00bom\x00bon\x00bp" +
-	"y\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx\x00brz\x00bsosbsj" +
-	"\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00buc\x00bud\x00bug" +
-	"\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr\x00bxh\x00bye" +
-	"\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf\x00bzh\x00bzw" +
-	"\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg\x00chhachk\x00" +
-	"chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00ckl\x00cko\x00ck" +
-	"y\x00cla\x00cme\x00cooscop\x00cps\x00crrecrj\x00crk\x00crl\x00crm\x00crs" +
-	"\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymdaandad\x00daf\x00dag\x00dah" +
-	"\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00ddn\x00deeuded\x00den\x00d" +
-	"ga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia\x00dje\x00dnj\x00dob\x00doi" +
-	"\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm\x00dtp\x00dts\x00dty\x00dua" +
-	"\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00dyo\x00dyu\x00dzzodzg\x00ebu" +
-	"\x00eeweefi\x00egl\x00egy\x00eky\x00elllema\x00emi\x00enngenn\x00enq\x00" +
-	"eopoeri\x00es\x00\x05esu\x00etstetr\x00ett\x00etu\x00etx\x00euusewo\x00e" +
-	"xt\x00faasfaa\x00fab\x00fag\x00fai\x00fan\x00ffulffi\x00ffm\x00fiinfia" +
-	"\x00fil\x00fit\x00fjijflr\x00fmp\x00foaofod\x00fon\x00for\x00fpe\x00fqs" +
-	"\x00frrafrc\x00frp\x00frr\x00frs\x00fub\x00fud\x00fue\x00fuf\x00fuh\x00f" +
-	"uq\x00fur\x00fuv\x00fuy\x00fvr\x00fyrygalegaa\x00gaf\x00gag\x00gah\x00ga" +
-	"j\x00gam\x00gan\x00gaw\x00gay\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdla" +
-	"gde\x00gdn\x00gdr\x00geb\x00gej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gi" +
-	"l\x00gim\x00gjk\x00gjn\x00gju\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00" +
-	"gnrngnd\x00gng\x00god\x00gof\x00goi\x00gom\x00gon\x00gor\x00gos\x00got" +
-	"\x00grc\x00grt\x00grw\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00g" +
-	"ux\x00guz\x00gvlvgvf\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauha" +
-	"g\x00hak\x00ham\x00haw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif" +
-	"\x00hig\x00hih\x00hil\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj" +
-	"\x00hnn\x00hno\x00homohoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui" +
-	"\x00hyyehzerianaian\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd" +
-	"\x00idi\x00idu\x00ieleigboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw" +
-	"\x00ikx\x00ilo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00" +
-	"\x03iwm\x00iws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00j" +
-	"gk\x00jgo\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatka" +
-	"a\x00kab\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp" +
-	"\x00kbq\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl" +
-	"\x00kdt\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00k" +
-	"gp\x00kha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij" +
-	"\x00kiu\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klal" +
-	"kln\x00klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw" +
-	"\x00knanknp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
-	"\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
-	"rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
-	"\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
-	"us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
-	"\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
-	"\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
-	"ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
-	"d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
-	"\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
-	"\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
-	"lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
-	"w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
-	"\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
-	"\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
-	"\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
-	"min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
-	"ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
-	"e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
-	"mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
-	"us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
-	"\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
-	"\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
-	"bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
-	"\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
-	"if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
-	"dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
-	"nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
-	"\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
-	"\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
-	"opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
-	"\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
-	"\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
-	"\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
-	"ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
-	"f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
-	"rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
-	"ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
-	"\x00sah\x00saq\x00sas\x00sat\x00saz\x00sba\x00sbe\x00sbp\x00scrdsck\x00s" +
-	"cl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00sei\x00se" +
-	"s\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn\x00shu" +
-	"\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks\x00sllv" +
-	"sld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp\x00smq" +
-	"\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq\x00sou" +
-	"\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx\x00sssw" +
-	"ssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00sur\x00s" +
-	"us\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00syl\x00sy" +
-	"r\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf\x00tbg\x00" +
-	"tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelted\x00tem" +
-	"\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00thq\x00thr" +
-	"\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr\x00tkt" +
-	"\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00tog\x00" +
-	"toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssotsd\x00t" +
-	"sf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts\x00ttt" +
-	"\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00twq\x00t" +
-	"xg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli\x00umb" +
-	"\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00uvh\x00u" +
-	"vl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv\x00vls" +
-	"\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj\x00wal" +
-	"\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg\x00wib" +
-	"\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu\x00woolw" +
-	"ob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00xbi\x00xcr" +
-	"\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna\x00xnr\x00x" +
-	"og\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe\x00yam\x00yao" +
-	"\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb\x00yby\x00yer" +
-	"\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00yooryon\x00yrb" +
-	"\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw\x00zahazag\x00z" +
-	"bl\x00zdj\x00zea\x00zgh\x00zhhozia\x00zlm\x00zmi\x00zne\x00zuulzxx\x00zz" +
-	"a\x00\xff\xff\xff\xff"
-
-const langNoIndexOffset = 1319
-
-// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
-// in lookup tables. The language ids for these language codes are derived directly
-// from the letters and are not consecutive.
-// Size: 2197 bytes, 2197 elements
-var langNoIndex = [2197]uint8{
-	// Entry 0 - 3F
-	0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd7, 0x3b, 0xd2,
-	0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
-	0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
-	0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
-	0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
-	0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
-	0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
-	0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
-	// Entry 40 - 7F
-	0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
-	0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
-	0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
-	0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
-	0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
-	0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
-	0xa8, 0xff, 0x1f, 0x67, 0x7f, 0xeb, 0xef, 0xce,
-	0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
-	// Entry 80 - BF
-	0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
-	0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
-	0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
-	0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
-	0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
-	0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
-	0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
-	0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
-	// Entry C0 - FF
-	0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
-	0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56,
-	0x45, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
-	0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
-	0xbc, 0x87, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
-	0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
-	0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
-	0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
-	// Entry 100 - 13F
-	0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
-	0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
-	0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
-	0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
-	0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
-	0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
-	0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
-	0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
-	// Entry 140 - 17F
-	0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16,
-	0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
-	0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
-	0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
-	0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
-	0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
-	0x00, 0x00, 0x50, 0xd5, 0x2d, 0x00, 0x64, 0x35,
-	0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
-	// Entry 180 - 1BF
-	0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
-	0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
-	0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
-	// Entry 1C0 - 1FF
-	0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
-	0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
-	0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
-	0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
-	0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7e, 0xbf,
-	// Entry 200 - 23F
-	0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
-	0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
-	0xa4, 0x45, 0x25, 0x9b, 0x02, 0xcf, 0xe0, 0xdf,
-	0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3,
-	0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d,
-	0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
-	0x21, 0x12, 0x6c, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
-	0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
-	// Entry 240 - 27F
-	0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
-	0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0,
-	0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
-	0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
-	0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
-	0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
-	0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66,
-	// Entry 280 - 2BF
-	0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
-	0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
-	0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
-	0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
-	0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
-	0xe5, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
-	0x03, 0x00, 0x00, 0x00, 0xcc, 0x50, 0x40, 0x04,
-	0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
-	// Entry 2C0 - 2FF
-	0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
-	0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
-	0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
-	0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
-	0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
-	0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
-	0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
-	0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
-	// Entry 300 - 33F
-	0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
-	0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
-	0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
-	0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
-	0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
-	0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
-	0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
-	0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
-	// Entry 340 - 37F
-	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
-	0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
-	0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
-	0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
-	0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
-	0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
-	0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0xff,
-	0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
-	// Entry 380 - 3BF
-	0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
-	0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
-	0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
-	0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
-	0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
-	0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
-	0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
-	0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
-	// Entry 3C0 - 3FF
-	0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
-	0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
-	0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
-	0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
-	0x84, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
-	0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
-	0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
-	0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
-	// Entry 400 - 43F
-	0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
-	0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
-	0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
-	0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
-	0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
-	0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
-	0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
-	0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
-	// Entry 440 - 47F
-	0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
-	0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
-	0x7f, 0x4e, 0xbf, 0x8e, 0xae, 0xff, 0xee, 0xdf,
-	0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
-	0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
-	0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd,
-	0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
-	0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x04, 0x44,
-	// Entry 480 - 4BF
-	0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb,
-	0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
-	0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
-	0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
-	0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
-	0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
-	0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
-	// Entry 4C0 - 4FF
-	0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
-	0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
-	0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
-	0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
-	0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
-	0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
-	0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
-	// Entry 500 - 53F
-	0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
-	0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
-	0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
-	0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7,
-	0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
-	0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
-	0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
-	0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
-	// Entry 540 - 57F
-	0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	// Entry 580 - 5BF
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
-	0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
-	0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
-	0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
-	0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
-	0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
-	0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
-	// Entry 5C0 - 5FF
-	0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
-	0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
-	0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
-	0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
-	0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
-	0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
-	0x00, 0x1f, 0xdf, 0xf2, 0xb9, 0xff, 0xfd, 0x3f,
-	0x1f, 0x18, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe,
-	// Entry 600 - 63F
-	0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
-	0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
-	0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
-	0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
-	0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
-	0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
-	0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
-	0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
-	// Entry 640 - 67F
-	0x75, 0xc4, 0x7d, 0x81, 0x82, 0xf1, 0x57, 0x6c,
-	0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
-	0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98,
-	0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
-	0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
-	0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
-	0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
-	0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
-	// Entry 680 - 6BF
-	0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
-	0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda,
-	0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
-	0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
-	0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
-	0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
-	0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
-	0x04, 0x00, 0x10, 0x8c, 0x58, 0xd5, 0x0d, 0x0f,
-	// Entry 6C0 - 6FF
-	0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
-	0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
-	0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41,
-	0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
-	0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
-	0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
-	// Entry 700 - 73F
-	0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
-	0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
-	0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
-	0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
-	0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
-	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 740 - 77F
-	0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
-	0xa0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
-	0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
-	0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
-	0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
-	0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
-	0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
-	// Entry 780 - 7BF
-	0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
-	0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
-	0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
-	0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
-	0x78, 0x15, 0x50, 0x00, 0xa4, 0x84, 0xa9, 0x41,
-	0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
-	0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
-	0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
-	// Entry 7C0 - 7FF
-	0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42,
-	0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56,
-	0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
-	0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
-	0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
-	0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
-	0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
-	0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
-	// Entry 800 - 83F
-	0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
-	0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
-	0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
-	0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
-	0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
-	0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
-	0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
-	0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
-	// Entry 840 - 87F
-	0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
-	0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
-	0x84, 0x00, 0x23, 0xc0, 0x23, 0x24, 0x00, 0x00,
-	0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
-	0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
-	0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
-	0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
-	// Entry 880 - 8BF
-	0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
-	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
-	0x0a, 0x00, 0x80, 0x00, 0x00,
-}
-
-// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
-// to 2-letter language codes that cannot be derived using the method described above.
-// Each 3-letter code is followed by its 1-byte langID.
-const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
-
-// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
-// Size: 12 bytes, 6 elements
-var altLangIndex = [6]uint16{
-	0x0278, 0x03fd, 0x01f3, 0x03dc, 0x0139, 0x0200,
-}
-
-// langAliasMap maps langIDs to their suggested replacements.
-// Size: 644 bytes, 161 elements
-var langAliasMap = [161]fromTo{
-	0:   {from: 0x81, to: 0x87},
-	1:   {from: 0x181, to: 0x1a7},
-	2:   {from: 0x1eb, to: 0x1da},
-	3:   {from: 0x1f3, to: 0x1b5},
-	4:   {from: 0x200, to: 0x508},
-	5:   {from: 0x207, to: 0x206},
-	6:   {from: 0x307, to: 0x3d3},
-	7:   {from: 0x33e, to: 0x366},
-	8:   {from: 0x3fd, to: 0x428},
-	9:   {from: 0x470, to: 0x14e},
-	10:  {from: 0x486, to: 0x447},
-	11:  {from: 0x498, to: 0x20},
-	12:  {from: 0x533, to: 0x539},
-	13:  {from: 0x584, to: 0x129},
-	14:  {from: 0x625, to: 0x1ea6},
-	15:  {from: 0x646, to: 0x427},
-	16:  {from: 0x657, to: 0x427},
-	17:  {from: 0x6e2, to: 0x39},
-	18:  {from: 0x6ed, to: 0x1d0},
-	19:  {from: 0x733, to: 0x2196},
-	20:  {from: 0x7a8, to: 0x55},
-	21:  {from: 0x7ae, to: 0x2990},
-	22:  {from: 0x7ba, to: 0x57},
-	23:  {from: 0x7db, to: 0x140},
-	24:  {from: 0x801, to: 0x59},
-	25:  {from: 0x80a, to: 0x8c},
-	26:  {from: 0x873, to: 0x805},
-	27:  {from: 0x8b8, to: 0xed8},
-	28:  {from: 0x9e4, to: 0x328},
-	29:  {from: 0xa2b, to: 0x2bc},
-	30:  {from: 0xa32, to: 0xbd},
-	31:  {from: 0xab3, to: 0x3317},
-	32:  {from: 0xb2d, to: 0x51f},
-	33:  {from: 0xb6a, to: 0x264f},
-	34:  {from: 0xb73, to: 0xbb8},
-	35:  {from: 0xb90, to: 0x444},
-	36:  {from: 0xbb1, to: 0x421e},
-	37:  {from: 0xbb4, to: 0x51f},
-	38:  {from: 0xbf3, to: 0x2d9c},
-	39:  {from: 0xc23, to: 0x3176},
-	40:  {from: 0xcae, to: 0xf0},
-	41:  {from: 0xcfd, to: 0xf6},
-	42:  {from: 0xdbd, to: 0x116},
-	43:  {from: 0xdcc, to: 0x324},
-	44:  {from: 0xded, to: 0xdf0},
-	45:  {from: 0xdf3, to: 0x526},
-	46:  {from: 0xed4, to: 0x204f},
-	47:  {from: 0xee3, to: 0x2e8f},
-	48:  {from: 0xf2e, to: 0x35e},
-	49:  {from: 0x10c5, to: 0x13b},
-	50:  {from: 0x10f9, to: 0x2c7},
-	51:  {from: 0x1195, to: 0x1e4},
-	52:  {from: 0x126e, to: 0x20},
-	53:  {from: 0x1419, to: 0x159},
-	54:  {from: 0x1465, to: 0x149},
-	55:  {from: 0x1514, to: 0xd90},
-	56:  {from: 0x1518, to: 0x387},
-	57:  {from: 0x1527, to: 0x16ba},
-	58:  {from: 0x1575, to: 0x208},
-	59:  {from: 0x1578, to: 0x109},
-	60:  {from: 0x1598, to: 0x3ca4},
-	61:  {from: 0x165f, to: 0x195},
-	62:  {from: 0x16bd, to: 0x131},
-	63:  {from: 0x16f5, to: 0x29ed},
-	64:  {from: 0x170d, to: 0x18e},
-	65:  {from: 0x171c, to: 0xf34},
-	66:  {from: 0x176f, to: 0x1519},
-	67:  {from: 0x17fe, to: 0x17ab},
-	68:  {from: 0x180b, to: 0x18e8},
-	69:  {from: 0x187f, to: 0x42c},
-	70:  {from: 0x196e, to: 0x1cf6},
-	71:  {from: 0x1a69, to: 0x2ba5},
-	72:  {from: 0x1a7f, to: 0x1f0},
-	73:  {from: 0x1b4f, to: 0x1f2},
-	74:  {from: 0x1b7b, to: 0x150a},
-	75:  {from: 0x202d, to: 0x37a6},
-	76:  {from: 0x2032, to: 0x20d2},
-	77:  {from: 0x204f, to: 0x302},
-	78:  {from: 0x20d8, to: 0x26b},
-	79:  {from: 0x20e3, to: 0x25a},
-	80:  {from: 0x20e7, to: 0x225},
-	81:  {from: 0x20ee, to: 0x24d},
-	82:  {from: 0x2104, to: 0x21e0},
-	83:  {from: 0x212a, to: 0x274},
-	84:  {from: 0x218e, to: 0x11d},
-	85:  {from: 0x21c3, to: 0x1556},
-	86:  {from: 0x21db, to: 0x4fa},
-	87:  {from: 0x21e9, to: 0x495},
-	88:  {from: 0x2222, to: 0x11d},
-	89:  {from: 0x222c, to: 0x11d},
-	90:  {from: 0x2257, to: 0x91f},
-	91:  {from: 0x230b, to: 0x321b},
-	92:  {from: 0x2377, to: 0x335a},
-	93:  {from: 0x2467, to: 0x2be},
-	94:  {from: 0x24d9, to: 0x2f6},
-	95:  {from: 0x24e5, to: 0x2f1},
-	96:  {from: 0x24ef, to: 0x316},
-	97:  {from: 0x2545, to: 0xb50},
-	98:  {from: 0x259e, to: 0xe0},
-	99:  {from: 0x2633, to: 0x2c7},
-	100: {from: 0x26be, to: 0x26a9},
-	101: {from: 0x26ee, to: 0x3bf},
-	102: {from: 0x271c, to: 0x3ca4},
-	103: {from: 0x275a, to: 0x26a9},
-	104: {from: 0x277e, to: 0x434d},
-	105: {from: 0x28e4, to: 0x282c},
-	106: {from: 0x2909, to: 0x348},
-	107: {from: 0x297b, to: 0x2d9c},
-	108: {from: 0x2b0f, to: 0x384},
-	109: {from: 0x2bf1, to: 0x38c},
-	110: {from: 0x2c34, to: 0x3ca4},
-	111: {from: 0x2cf1, to: 0x3b5},
-	112: {from: 0x2d08, to: 0x58c},
-	113: {from: 0x2d3c, to: 0x143},
-	114: {from: 0x2d3d, to: 0x143},
-	115: {from: 0x2df4, to: 0x2e8},
-	116: {from: 0x2dfd, to: 0x19c1},
-	117: {from: 0x2e0f, to: 0x2d8a},
-	118: {from: 0x2e16, to: 0x289},
-	119: {from: 0x2e49, to: 0x7c},
-	120: {from: 0x2e5a, to: 0x2277},
-	121: {from: 0x2e95, to: 0x2e90},
-	122: {from: 0x2ee4, to: 0x2ecc},
-	123: {from: 0x3188, to: 0x3bb},
-	124: {from: 0x335b, to: 0x3383},
-	125: {from: 0x341f, to: 0x3d3},
-	126: {from: 0x34e3, to: 0x18c5},
-	127: {from: 0x35db, to: 0x408},
-	128: {from: 0x364d, to: 0x23e},
-	129: {from: 0x366b, to: 0x3ea},
-	130: {from: 0x36f2, to: 0x43b},
-	131: {from: 0x37b5, to: 0x11d},
-	132: {from: 0x380b, to: 0x38e7},
-	133: {from: 0x3820, to: 0x2c90},
-	134: {from: 0x3824, to: 0xa7},
-	135: {from: 0x3827, to: 0x321d},
-	136: {from: 0x3861, to: 0x399b},
-	137: {from: 0x3887, to: 0x3fb5},
-	138: {from: 0x389a, to: 0x39cc},
-	139: {from: 0x38a9, to: 0x1f99},
-	140: {from: 0x38aa, to: 0x2e8f},
-	141: {from: 0x3951, to: 0x474},
-	142: {from: 0x3b43, to: 0xd86},
-	143: {from: 0x3b6d, to: 0x132},
-	144: {from: 0x3c8e, to: 0x4b2},
-	145: {from: 0x3fb2, to: 0xfc},
-	146: {from: 0x41fd, to: 0xa86},
-	147: {from: 0x42b3, to: 0x568},
-	148: {from: 0x42ee, to: 0x3f55},
-	149: {from: 0x436d, to: 0x251},
-	150: {from: 0x43c0, to: 0x36c0},
-	151: {from: 0x43c2, to: 0x10b},
-	152: {from: 0x44a4, to: 0x3317},
-	153: {from: 0x44d8, to: 0x508},
-	154: {from: 0x45bf, to: 0x23fe},
-	155: {from: 0x45d2, to: 0x26d1},
-	156: {from: 0x4605, to: 0x48a3},
-	157: {from: 0x46a3, to: 0x4695},
-	158: {from: 0x4733, to: 0x473a},
-	159: {from: 0x490b, to: 0x316},
-	160: {from: 0x499c, to: 0x519},
-}
-
-// Size: 161 bytes, 161 elements
-var langAliasTypes = [161]langAliasType{
-	// Entry 0 - 3F
-	1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
-	1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0,
-	2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0,
-	2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0,
-	// Entry 40 - 7F
-	1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 1, 1, 1,
-	1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 2, 2,
-	2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, 0, 1,
-	0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 2,
-	// Entry 80 - BF
-	1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, 0,
-	1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, 1,
-	1,
-}
-
 const (
-	_Latn = 82
-	_Hani = 50
-	_Hans = 52
-	_Hant = 53
-	_Qaaa = 131
-	_Qaai = 139
-	_Qabx = 180
-	_Zinh = 224
-	_Zyyy = 229
-	_Zzzz = 230
+	_Latn = 87
+	_Hani = 54
+	_Hans = 56
+	_Hant = 57
+	_Qaaa = 139
+	_Qaai = 147
+	_Qabx = 188
+	_Zinh = 236
+	_Zyyy = 241
+	_Zzzz = 242
 )
 
-// script is an alphabetically sorted list of ISO 15924 codes. The index
-// of the script in the string, divided by 4, is the internal scriptID.
-const script tag.Index = "" + // Size: 928 bytes
-	"----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
-	"BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCprtCyrlCyrsDevaDsrtDuplEgyd" +
-	"EgyhEgypElbaEthiGeokGeorGlagGothGranGrekGujrGuruHanbHangHaniHanoHansHant" +
-	"HatrHebrHiraHluwHmngHrktHungIndsItalJamoJavaJpanJurcKaliKanaKharKhmrKhoj" +
-	"KitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepcLimbLinaLinbLisuLoma" +
-	"LyciLydiMahjMandManiMarcMayaMendMercMeroMlymModiMongMoonMrooMteiMultMymr" +
-	"NarbNbatNewaNkgbNkooNshuOgamOlckOrkhOryaOsgeOsmaPalmPaucPermPhagPhliPhlp" +
-	"PhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" +
-	"QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" +
-	"QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" +
-	"QabxRjngRoroRunrSamrSaraSarbSaurSgnwShawShrdSiddSindSinhSoraSundSyloSyrc" +
-	"SyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglgThaaThaiTibtTirh" +
-	"UgarVaiiVispWaraWoleXpeoXsuxYiiiZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff" +
-	"\xff"
-
-// suppressScript is an index from langID to the dominant script for that language,
-// if it exists.  If a script is given, it should be suppressed from the language tag.
-// Size: 1319 bytes, 1319 elements
-var suppressScript = [1319]uint8{
+var regionToGroups = []uint8{ // 357 elements
 	// Entry 0 - 3F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x27, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04,
+	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00,
+	0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00,
+	0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04,
 	// Entry 40 - 7F
-	0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x1e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00,
+	0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00,
+	0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08,
+	0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00,
 	// Entry 80 - BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00,
+	0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04,
+	0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00,
+	0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00,
 	// Entry C0 - FF
+	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01,
+	0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00,
+	0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x52, 0x52, 0x00, 0x00,
 	// Entry 100 - 13F
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00,
-	0x00, 0xd6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x2d, 0x00, 0x00, 0x52, 0x00, 0x00, 0x52,
-	0x00, 0x52, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
-	// Entry 140 - 17F
-	0x52, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
-	0x52, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x52, 0x00, 0x00, 0x52, 0x52, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x52, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 180 - 1BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x52, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x52, 0x2e, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x37, 0x00, 0x20,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 1C0 - 1FF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x52, 0x52, 0x00, 0x52, 0x52, 0x00,
-	0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
-	0x52, 0x52, 0x00, 0x37, 0x00, 0x00, 0x00, 0x00,
-	0x41, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 200 - 23F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x29, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x1e, 0x00, 0x00, 0x52, 0x00, 0x00,
-	// Entry 240 - 27F
-	0x00, 0x00, 0x46, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x4a, 0x00, 0x4b, 0x00, 0x20, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 280 - 2BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x4f,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
-	// Entry 2C0 - 2FF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00,
-	0x00, 0x00, 0x00, 0x64, 0x00, 0x00, 0x00, 0x00,
-	// Entry 300 - 33F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x52, 0x52,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x6b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
-	// Entry 340 - 37F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x52,
-	0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
-	0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x70, 0x52, 0x00, 0x00,
-	0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
-	// Entry 380 - 3BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
-	0x00, 0x00, 0x00, 0x00, 0x75, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x2f, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x52,
-	0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
-	// Entry 3C0 - 3FF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
-	0x52, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x1e, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 400 - 43F
-	0x00, 0x00, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
-	0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
-	0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x52, 0x52, 0x00, 0x00, 0x00, 0x00,
-	// Entry 440 - 47F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xcd, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xd0,
-	0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0xd5, 0x00, 0x00, 0x00, 0x27, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
-	0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x52, 0x00,
-	0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
-	// Entry 480 - 4BF
-	0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
-	0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 4C0 - 4FF
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00,
+	0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00,
+	0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00,
+	// Entry 140 - 17F
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 500 - 53F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x37, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
-}
-
-const (
-	_001 = 1
-	_419 = 30
-	_BR  = 64
-	_CA  = 72
-	_ES  = 109
-	_GB  = 122
-	_MD  = 187
-	_PT  = 237
-	_UK  = 305
-	_US  = 308
-	_ZZ  = 356
-	_XA  = 322
-	_XC  = 324
-	_XK  = 332
-)
-
-// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
-// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
-// the UN.M49 codes used for groups.)
-const isoRegionOffset = 31
-
-// regionTypes defines the status of a region for various standards.
-// Size: 357 bytes, 357 elements
-var regionTypes = [357]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 40 - 7F
-	0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, 0x00,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
-	0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
-	0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 80 - BF
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry C0 - FF
-	0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06,
-	0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
-	0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	// Entry 100 - 13F
-	0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 140 - 17F
-	0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, 0x04,
-	0x06, 0x06, 0x04, 0x06, 0x05,
-}
-
-// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
-// Each 2-letter codes is followed by two bytes with the following meaning:
-//     - [A-Z}{2}: the first letter of the 2-letter code plus these two
-//                 letters form the 3-letter ISO code.
-//     - 0, n:     index into altRegionISO3.
-const regionISO tag.Index = "" + // Size: 1308 bytes
-	"AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
-	"AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
-	"BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
-	"CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
-	"HYDZZAEA  ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ  FIINFJJIFKLKFMSMFORO" +
-	"FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
-	"RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC  IDDNIERLILSR" +
-	"IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
-	"\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
-	"LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
-	"MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
-	"NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
-	"\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
-	"QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
-	"SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
-	"SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
-	"UVTWWNTZZAUAKRUGGAUK  UMMIUN  USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
-	"UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
-	"OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
-	"ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
-
-// altRegionISO3 holds a list of 3-letter region codes that cannot be
-// mapped to 2-letter codes using the default algorithm. This is a short list.
-const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
-
-// altRegionIDs holds a list of regionIDs the positions of which match those
-// of the 3-letter ISO codes in altRegionISO3.
-// Size: 22 bytes, 11 elements
-var altRegionIDs = [11]uint16{
-	0x0056, 0x006f, 0x0087, 0x00a7, 0x00a9, 0x00ac, 0x00e9, 0x0104,
-	0x0120, 0x015e, 0x00db,
-}
-
-// Size: 80 bytes, 20 elements
-var regionOldMap = [20]fromTo{
-	0:  {from: 0x43, to: 0xc3},
-	1:  {from: 0x57, to: 0xa6},
-	2:  {from: 0x5e, to: 0x5f},
-	3:  {from: 0x65, to: 0x3a},
-	4:  {from: 0x78, to: 0x77},
-	5:  {from: 0x92, to: 0x36},
-	6:  {from: 0xa2, to: 0x132},
-	7:  {from: 0xc0, to: 0x132},
-	8:  {from: 0xd6, to: 0x13e},
-	9:  {from: 0xdb, to: 0x2a},
-	10: {from: 0xee, to: 0x132},
-	11: {from: 0xf1, to: 0xe1},
-	12: {from: 0xfb, to: 0x6f},
-	13: {from: 0x102, to: 0x163},
-	14: {from: 0x129, to: 0x125},
-	15: {from: 0x131, to: 0x7a},
-	16: {from: 0x139, to: 0x13d},
-	17: {from: 0x140, to: 0x132},
-	18: {from: 0x15c, to: 0x15d},
-	19: {from: 0x162, to: 0x4a},
-}
-
-// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
-// codes indicating collections of regions.
-// Size: 714 bytes, 357 elements
-var m49 = [357]int16{
-	// Entry 0 - 3F
-	0, 1, 2, 3, 5, 9, 11, 13,
-	14, 15, 17, 18, 19, 21, 29, 30,
-	34, 35, 39, 53, 54, 57, 61, 142,
-	143, 145, 150, 151, 154, 155, 419, 958,
-	0, 20, 784, 4, 28, 660, 8, 51,
-	530, 24, 10, 32, 16, 40, 36, 533,
-	248, 31, 70, 52, 50, 56, 854, 100,
-	48, 108, 204, 652, 60, 96, 68, 535,
-	// Entry 40 - 7F
-	76, 44, 64, 104, 74, 72, 112, 84,
-	124, 166, 180, 140, 178, 756, 384, 184,
-	152, 120, 156, 170, 0, 188, 891, 296,
-	192, 132, 531, 162, 196, 203, 278, 276,
-	0, 262, 208, 212, 214, 204, 12, 0,
-	218, 233, 818, 732, 232, 724, 231, 967,
-	0, 246, 242, 238, 583, 234, 0, 250,
-	249, 266, 826, 308, 268, 254, 831, 288,
-	// Entry 80 - BF
-	292, 304, 270, 324, 312, 226, 300, 239,
-	320, 316, 624, 328, 344, 334, 340, 191,
-	332, 348, 854, 0, 360, 372, 376, 833,
-	356, 86, 368, 364, 352, 380, 832, 388,
-	400, 392, 581, 404, 417, 116, 296, 174,
-	659, 408, 410, 414, 136, 398, 418, 422,
-	662, 438, 144, 430, 426, 440, 442, 428,
-	434, 504, 492, 498, 499, 663, 450, 584,
-	// Entry C0 - FF
-	581, 807, 466, 104, 496, 446, 580, 474,
-	478, 500, 470, 480, 462, 454, 484, 458,
-	508, 516, 540, 562, 574, 566, 548, 558,
-	528, 578, 524, 10, 520, 536, 570, 554,
-	512, 591, 0, 604, 258, 598, 608, 586,
-	616, 666, 612, 630, 275, 620, 581, 585,
-	600, 591, 634, 959, 960, 961, 962, 963,
-	964, 965, 966, 967, 968, 969, 970, 971,
-	// Entry 100 - 13F
-	972, 638, 716, 642, 688, 643, 646, 682,
-	90, 690, 729, 752, 702, 654, 705, 744,
-	703, 694, 674, 686, 706, 740, 728, 678,
-	810, 222, 534, 760, 748, 0, 796, 148,
-	260, 768, 764, 762, 772, 626, 795, 788,
-	776, 626, 792, 780, 798, 158, 834, 804,
-	800, 826, 581, 0, 840, 858, 860, 336,
-	670, 704, 862, 92, 850, 704, 548, 876,
-	// Entry 140 - 17F
-	581, 882, 973, 974, 975, 976, 977, 978,
-	979, 980, 981, 982, 983, 984, 985, 986,
-	987, 988, 989, 990, 991, 992, 993, 994,
-	995, 996, 997, 998, 720, 887, 175, 891,
-	710, 894, 180, 716, 999,
-}
-
-// m49Index gives indexes into fromM49 based on the three most significant bits
-// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
-//    fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
-// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
-// The region code is stored in the 9 lsb of the indexed value.
-// Size: 18 bytes, 9 elements
-var m49Index = [9]int16{
-	0, 59, 107, 142, 180, 219, 258, 290,
-	332,
-}
-
-// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
-// Size: 664 bytes, 332 elements
-var fromM49 = [332]uint16{
-	// Entry 0 - 3F
-	0x0201, 0x0402, 0x0603, 0x0823, 0x0a04, 0x1026, 0x1205, 0x142a,
-	0x1606, 0x1866, 0x1a07, 0x1c08, 0x1e09, 0x202c, 0x220a, 0x240b,
-	0x260c, 0x2821, 0x2a0d, 0x3029, 0x3824, 0x3a0e, 0x3c0f, 0x3e31,
-	0x402b, 0x4410, 0x4611, 0x482e, 0x4e12, 0x502d, 0x5841, 0x6038,
-	0x6434, 0x6627, 0x6833, 0x6a13, 0x6c14, 0x7035, 0x7215, 0x783c,
-	0x7a16, 0x8042, 0x883e, 0x8c32, 0x9045, 0x9444, 0x9840, 0xa847,
-	0xac99, 0xb508, 0xb93b, 0xc03d, 0xc837, 0xd0c3, 0xd839, 0xe046,
-	0xe8a5, 0xf051, 0xf848, 0x0859, 0x10ac, 0x184b, 0x1c17, 0x1e18,
-	// Entry 40 - 7F
-	0x20b2, 0x2219, 0x291f, 0x2c1a, 0x2e1b, 0x3050, 0x341c, 0x361d,
-	0x3852, 0x3d2d, 0x445b, 0x4c49, 0x5453, 0x5ca7, 0x5f5e, 0x644c,
-	0x684a, 0x704f, 0x7855, 0x7e8f, 0x8058, 0x885c, 0x965d, 0x983a,
-	0xa062, 0xa863, 0xac64, 0xb468, 0xbd19, 0xc485, 0xcc6e, 0xce6e,
-	0xd06c, 0xd269, 0xd475, 0xdc73, 0xde87, 0xe472, 0xec71, 0xf030,
-	0xf278, 0xf477, 0xfc7d, 0x04e4, 0x0920, 0x0c61, 0x1479, 0x187c,
-	0x1c82, 0x26ec, 0x285f, 0x2c5e, 0x305f, 0x407f, 0x4880, 0x50a6,
-	0x5886, 0x6081, 0x687b, 0x7084, 0x7889, 0x8088, 0x8883, 0x908b,
-	// Entry 80 - BF
-	0x9890, 0x9c8d, 0xa137, 0xa88e, 0xb08c, 0xb891, 0xc09c, 0xc898,
-	0xd094, 0xd89b, 0xe09a, 0xe895, 0xf096, 0xf89d, 0x004e, 0x089f,
-	0x10a1, 0x1cad, 0x20a0, 0x28a3, 0x30a9, 0x34aa, 0x3cab, 0x42a4,
-	0x44ae, 0x461e, 0x4caf, 0x54b4, 0x58b7, 0x5cb3, 0x64b8, 0x6cb1,
-	0x70b5, 0x74b6, 0x7cc5, 0x84be, 0x8ccd, 0x94cf, 0x9ccc, 0xa4c2,
-	0xacca, 0xb4c7, 0xbcc8, 0xc0cb, 0xc8ce, 0xd8ba, 0xe0c4, 0xe4bb,
-	0xe6bc, 0xe8c9, 0xf0b9, 0xf8d0, 0x00e0, 0x08d1, 0x10dc, 0x18da,
-	0x20d8, 0x2428, 0x265a, 0x2a2f, 0x2d1a, 0x2e3f, 0x30dd, 0x38d2,
-	// Entry C0 - FF
-	0x493e, 0x54df, 0x5cd7, 0x64d3, 0x6cd5, 0x74de, 0x7cd4, 0x84d9,
-	0x88c6, 0x8b32, 0x8e74, 0x90bf, 0x92ef, 0x94e7, 0x9ee1, 0xace5,
-	0xb0f0, 0xb8e3, 0xc0e6, 0xc8ea, 0xd0e8, 0xd8ed, 0xe08a, 0xe525,
-	0xeceb, 0xf4f2, 0xfd01, 0x0503, 0x0705, 0x0d06, 0x183b, 0x1d0d,
-	0x26a8, 0x2825, 0x2cb0, 0x2ebd, 0x34e9, 0x3d38, 0x4512, 0x4d17,
-	0x5507, 0x5d13, 0x6104, 0x6509, 0x6d11, 0x7d0c, 0x7f10, 0x813d,
-	0x830e, 0x8514, 0x8d60, 0x9963, 0xa15c, 0xa86d, 0xb116, 0xb30a,
-	0xb86b, 0xc10a, 0xc915, 0xd10f, 0xd91c, 0xe10b, 0xe84d, 0xf11b,
-	// Entry 100 - 13F
-	0xf523, 0xf922, 0x0121, 0x0924, 0x1128, 0x192b, 0x2022, 0x2927,
-	0x312a, 0x3726, 0x391e, 0x3d2c, 0x4130, 0x492f, 0x4ec1, 0x5518,
-	0x646a, 0x747a, 0x7e7e, 0x809e, 0x8297, 0x852e, 0x9134, 0xa53c,
-	0xac36, 0xb535, 0xb936, 0xbd3a, 0xd93f, 0xe541, 0xed5d, 0xef5d,
-	0xf656, 0xfd61, 0x7c1f, 0x7ef3, 0x80f4, 0x82f5, 0x84f6, 0x86f7,
-	0x88f8, 0x8af9, 0x8cfa, 0x8e6f, 0x90fc, 0x92fd, 0x94fe, 0x96ff,
-	0x9900, 0x9b42, 0x9d43, 0x9f44, 0xa145, 0xa346, 0xa547, 0xa748,
-	0xa949, 0xab4a, 0xad4b, 0xaf4c, 0xb14d, 0xb34e, 0xb54f, 0xb750,
-	// Entry 140 - 17F
-	0xb951, 0xbb52, 0xbd53, 0xbf54, 0xc155, 0xc356, 0xc557, 0xc758,
-	0xc959, 0xcb5a, 0xcd5b, 0xcf64,
-}
-
-// Size: 1463 bytes
-var variantIndex = map[string]uint8{
-	"1606nict": 0x0,
-	"1694acad": 0x1,
-	"1901":     0x2,
-	"1959acad": 0x3,
-	"1994":     0x45,
-	"1996":     0x4,
-	"abl1943":  0x5,
-	"alalc97":  0x47,
-	"aluku":    0x6,
-	"ao1990":   0x7,
-	"arevela":  0x8,
-	"arevmda":  0x9,
-	"baku1926": 0xa,
-	"balanka":  0xb,
-	"barla":    0xc,
-	"basiceng": 0xd,
-	"bauddha":  0xe,
-	"biscayan": 0xf,
-	"biske":    0x40,
-	"bohoric":  0x10,
-	"boont":    0x11,
-	"colb1945": 0x12,
-	"cornu":    0x13,
-	"dajnko":   0x14,
-	"ekavsk":   0x15,
-	"emodeng":  0x16,
-	"fonipa":   0x48,
-	"fonnapa":  0x49,
-	"fonupa":   0x4a,
-	"fonxsamp": 0x4b,
-	"hepburn":  0x17,
-	"heploc":   0x46,
-	"hognorsk": 0x18,
-	"ijekavsk": 0x19,
-	"itihasa":  0x1a,
-	"jauer":    0x1b,
-	"jyutping": 0x1c,
-	"kkcor":    0x1d,
-	"kociewie": 0x1e,
-	"kscor":    0x1f,
-	"laukika":  0x20,
-	"lipaw":    0x41,
-	"luna1918": 0x21,
-	"metelko":  0x22,
-	"monoton":  0x23,
-	"ndyuka":   0x24,
-	"nedis":    0x25,
-	"newfound": 0x26,
-	"njiva":    0x42,
-	"nulik":    0x27,
-	"osojs":    0x43,
-	"oxendict": 0x28,
-	"pamaka":   0x29,
-	"petr1708": 0x2a,
-	"pinyin":   0x2b,
-	"polyton":  0x2c,
-	"puter":    0x2d,
-	"rigik":    0x2e,
-	"rozaj":    0x2f,
-	"rumgr":    0x30,
-	"scotland": 0x31,
-	"scouse":   0x32,
-	"simple":   0x4c,
-	"solba":    0x44,
-	"sotav":    0x33,
-	"surmiran": 0x34,
-	"sursilv":  0x35,
-	"sutsilv":  0x36,
-	"tarask":   0x37,
-	"uccor":    0x38,
-	"ucrcor":   0x39,
-	"ulster":   0x3a,
-	"unifon":   0x3b,
-	"vaidika":  0x3c,
-	"valencia": 0x3d,
-	"vallader": 0x3e,
-	"wadegile": 0x3f,
-}
+	0x00, 0x00, 0x00, 0x00, 0x00,
+} // Size: 381 bytes
 
-// variantNumSpecialized is the number of specialized variants in variants.
-const variantNumSpecialized = 71
-
-// nRegionGroups is the number of region groups.
-const nRegionGroups = 32
-
-type likelyLangRegion struct {
-	lang   uint16
-	region uint16
-}
-
-// likelyScript is a lookup table, indexed by scriptID, for the most likely
-// languages and regions given a script.
-// Size: 928 bytes, 232 elements
-var likelyScript = [232]likelyLangRegion{
-	1:   {lang: 0x149, region: 0x83},
-	3:   {lang: 0x299, region: 0x105},
-	4:   {lang: 0x1e, region: 0x98},
-	5:   {lang: 0x39, region: 0x6a},
-	7:   {lang: 0x3a, region: 0x9b},
-	8:   {lang: 0x1d0, region: 0x27},
-	9:   {lang: 0x12, region: 0x9b},
-	10:  {lang: 0x5a, region: 0x94},
-	11:  {lang: 0x5f, region: 0x51},
-	12:  {lang: 0xb7, region: 0xb3},
-	13:  {lang: 0x62, region: 0x94},
-	14:  {lang: 0xa3, region: 0x34},
-	15:  {lang: 0x3e0, region: 0x98},
-	17:  {lang: 0x51f, region: 0x12d},
-	18:  {lang: 0x3a8, region: 0x98},
-	19:  {lang: 0x159, region: 0x77},
-	20:  {lang: 0xc0, region: 0x94},
-	21:  {lang: 0x9b, region: 0xe6},
-	22:  {lang: 0xd9, region: 0x34},
-	23:  {lang: 0xf0, region: 0x48},
-	24:  {lang: 0x4e6, region: 0x12a},
-	25:  {lang: 0xe5, region: 0x13d},
-	26:  {lang: 0xe3, region: 0x134},
-	28:  {lang: 0xee, region: 0x6a},
-	29:  {lang: 0x199, region: 0x5c},
-	30:  {lang: 0x3d9, region: 0x105},
-	32:  {lang: 0x1b7, region: 0x98},
-	34:  {lang: 0x159, region: 0x77},
-	37:  {lang: 0x12f, region: 0x6a},
-	38:  {lang: 0x427, region: 0x26},
-	39:  {lang: 0x26, region: 0x6e},
-	41:  {lang: 0x208, region: 0x7c},
-	42:  {lang: 0xfa, region: 0x37},
-	43:  {lang: 0x198, region: 0x12f},
-	44:  {lang: 0x3e0, region: 0x98},
-	45:  {lang: 0x131, region: 0x86},
-	46:  {lang: 0x19d, region: 0x98},
-	47:  {lang: 0x394, region: 0x98},
-	48:  {lang: 0x51f, region: 0x12d},
-	49:  {lang: 0x24b, region: 0xaa},
-	50:  {lang: 0x51f, region: 0x52},
-	51:  {lang: 0x1c4, region: 0xe6},
-	52:  {lang: 0x51f, region: 0x52},
-	53:  {lang: 0x51f, region: 0x12d},
-	54:  {lang: 0x2f4, region: 0x9a},
-	55:  {lang: 0x1b5, region: 0x96},
-	56:  {lang: 0x1f8, region: 0xa1},
-	57:  {lang: 0x1be, region: 0x12a},
-	58:  {lang: 0x1c3, region: 0xae},
-	60:  {lang: 0x1ce, region: 0x91},
-	62:  {lang: 0x13d, region: 0x9d},
-	63:  {lang: 0x24b, region: 0xaa},
-	64:  {lang: 0x206, region: 0x94},
-	65:  {lang: 0x1f8, region: 0xa1},
-	67:  {lang: 0x130, region: 0xc3},
-	68:  {lang: 0x1f8, region: 0xa1},
-	69:  {lang: 0x3b2, region: 0xe7},
-	70:  {lang: 0x242, region: 0xa5},
-	71:  {lang: 0x3f0, region: 0x98},
-	74:  {lang: 0x249, region: 0x98},
-	75:  {lang: 0x24b, region: 0xaa},
-	77:  {lang: 0x87, region: 0x98},
-	78:  {lang: 0x367, region: 0x122},
-	79:  {lang: 0x2af, region: 0xae},
-	84:  {lang: 0x296, region: 0x98},
-	85:  {lang: 0x29f, region: 0x98},
-	86:  {lang: 0x286, region: 0x86},
-	87:  {lang: 0x199, region: 0x86},
-	88:  {lang: 0x2a3, region: 0x52},
-	90:  {lang: 0x4ea, region: 0x12a},
-	91:  {lang: 0x4eb, region: 0x12a},
-	92:  {lang: 0x1b7, region: 0x98},
-	93:  {lang: 0x32e, region: 0x9b},
-	94:  {lang: 0x4ed, region: 0x52},
-	95:  {lang: 0xa7, region: 0x52},
-	97:  {lang: 0x2df, region: 0x111},
-	98:  {lang: 0x4ee, region: 0x10a},
-	99:  {lang: 0x4ee, region: 0x10a},
-	100: {lang: 0x2fb, region: 0x98},
-	101: {lang: 0x312, region: 0x98},
-	102: {lang: 0x302, region: 0x52},
-	104: {lang: 0x315, region: 0x34},
-	105: {lang: 0x305, region: 0x98},
-	106: {lang: 0x40a, region: 0xe7},
-	107: {lang: 0x328, region: 0xc3},
-	108: {lang: 0x4ef, region: 0x107},
-	109: {lang: 0x3a, region: 0xa0},
-	110: {lang: 0x34a, region: 0xda},
-	112: {lang: 0x2c7, region: 0x83},
-	114: {lang: 0x3f9, region: 0x95},
-	115: {lang: 0x3e5, region: 0x98},
-	116: {lang: 0x392, region: 0xc4},
-	117: {lang: 0x38c, region: 0x98},
-	118: {lang: 0x390, region: 0x134},
-	119: {lang: 0x41f, region: 0x114},
-	120: {lang: 0x3a, region: 0x11b},
-	121: {lang: 0xf9, region: 0xc3},
-	122: {lang: 0x274, region: 0x105},
-	123: {lang: 0x2c0, region: 0x52},
-	124: {lang: 0x396, region: 0x9b},
-	125: {lang: 0x396, region: 0x52},
-	127: {lang: 0x3a4, region: 0xaf},
-	129: {lang: 0x1bf, region: 0x52},
-	130: {lang: 0x4f3, region: 0x9b},
-	181: {lang: 0x3c2, region: 0x94},
-	183: {lang: 0x369, region: 0x10b},
-	184: {lang: 0x416, region: 0x96},
-	186: {lang: 0x4f5, region: 0x15d},
-	187: {lang: 0x3e6, region: 0x98},
-	188: {lang: 0x44, region: 0x134},
-	189: {lang: 0x134, region: 0x7a},
-	190: {lang: 0x3e0, region: 0x98},
-	191: {lang: 0x3e0, region: 0x98},
-	192: {lang: 0x3f0, region: 0x98},
-	193: {lang: 0x402, region: 0xb2},
-	194: {lang: 0x429, region: 0x98},
-	195: {lang: 0x434, region: 0x94},
-	196: {lang: 0x443, region: 0x34},
-	197: {lang: 0x444, region: 0x9a},
-	201: {lang: 0x450, region: 0xe6},
-	202: {lang: 0x116, region: 0x98},
-	203: {lang: 0x454, region: 0x52},
-	204: {lang: 0x22a, region: 0x52},
-	205: {lang: 0x446, region: 0x98},
-	206: {lang: 0x49b, region: 0x52},
-	207: {lang: 0x9d, region: 0x13d},
-	208: {lang: 0x457, region: 0x98},
-	210: {lang: 0x51e, region: 0xb9},
-	211: {lang: 0x14e, region: 0xe6},
-	212: {lang: 0x124, region: 0xcc},
-	213: {lang: 0x461, region: 0x122},
-	214: {lang: 0xa7, region: 0x52},
-	215: {lang: 0x2c5, region: 0x98},
-	216: {lang: 0x4a3, region: 0x11b},
-	217: {lang: 0x4b4, region: 0xb3},
-	219: {lang: 0x1c7, region: 0x98},
-	221: {lang: 0x3a0, region: 0x9b},
-	222: {lang: 0x21, region: 0x9a},
-	223: {lang: 0x1e2, region: 0x52},
-}
-
-type likelyScriptRegion struct {
-	region uint16
-	script uint8
-	flags  uint8
-}
-
-// likelyLang is a lookup table, indexed by langID, for the most likely
-// scripts and regions given incomplete information. If more entries exist for a
-// given language, region and script are the index and size respectively
-// of the list in likelyLangList.
-// Size: 5276 bytes, 1319 elements
-var likelyLang = [1319]likelyScriptRegion{
-	0:    {region: 0x134, script: 0x52, flags: 0x0},
-	1:    {region: 0x6e, script: 0x52, flags: 0x0},
-	2:    {region: 0x164, script: 0x52, flags: 0x0},
-	3:    {region: 0x164, script: 0x52, flags: 0x0},
-	4:    {region: 0x164, script: 0x52, flags: 0x0},
-	5:    {region: 0x7c, script: 0x1e, flags: 0x0},
-	6:    {region: 0x164, script: 0x52, flags: 0x0},
-	7:    {region: 0x7f, script: 0x52, flags: 0x0},
-	8:    {region: 0x164, script: 0x52, flags: 0x0},
-	9:    {region: 0x164, script: 0x52, flags: 0x0},
-	10:   {region: 0x164, script: 0x52, flags: 0x0},
-	11:   {region: 0x94, script: 0x52, flags: 0x0},
-	12:   {region: 0x130, script: 0x52, flags: 0x0},
-	13:   {region: 0x7f, script: 0x52, flags: 0x0},
-	14:   {region: 0x164, script: 0x52, flags: 0x0},
-	15:   {region: 0x164, script: 0x52, flags: 0x0},
-	16:   {region: 0x105, script: 0x1e, flags: 0x0},
-	17:   {region: 0x164, script: 0x52, flags: 0x0},
-	18:   {region: 0x9b, script: 0x9, flags: 0x0},
-	19:   {region: 0x127, script: 0x5, flags: 0x0},
-	20:   {region: 0x164, script: 0x52, flags: 0x0},
-	21:   {region: 0x160, script: 0x52, flags: 0x0},
-	22:   {region: 0x164, script: 0x52, flags: 0x0},
-	23:   {region: 0x164, script: 0x52, flags: 0x0},
-	24:   {region: 0x164, script: 0x52, flags: 0x0},
-	25:   {region: 0x164, script: 0x52, flags: 0x0},
-	26:   {region: 0x164, script: 0x52, flags: 0x0},
-	27:   {region: 0x51, script: 0x52, flags: 0x0},
-	28:   {region: 0x164, script: 0x52, flags: 0x0},
-	29:   {region: 0x164, script: 0x52, flags: 0x0},
-	30:   {region: 0x98, script: 0x4, flags: 0x0},
-	31:   {region: 0x164, script: 0x52, flags: 0x0},
-	32:   {region: 0x7f, script: 0x52, flags: 0x0},
-	33:   {region: 0x9a, script: 0xde, flags: 0x0},
-	34:   {region: 0x164, script: 0x52, flags: 0x0},
-	35:   {region: 0x164, script: 0x52, flags: 0x0},
-	36:   {region: 0x14c, script: 0x52, flags: 0x0},
-	37:   {region: 0x105, script: 0x1e, flags: 0x0},
-	38:   {region: 0x6e, script: 0x27, flags: 0x0},
-	39:   {region: 0x164, script: 0x52, flags: 0x0},
-	40:   {region: 0x164, script: 0x52, flags: 0x0},
-	41:   {region: 0xd5, script: 0x52, flags: 0x0},
-	42:   {region: 0x164, script: 0x52, flags: 0x0},
-	44:   {region: 0x164, script: 0x52, flags: 0x0},
-	45:   {region: 0x164, script: 0x52, flags: 0x0},
-	46:   {region: 0x164, script: 0x52, flags: 0x0},
-	47:   {region: 0x164, script: 0x52, flags: 0x0},
-	48:   {region: 0x164, script: 0x52, flags: 0x0},
-	49:   {region: 0x164, script: 0x52, flags: 0x0},
-	50:   {region: 0x94, script: 0x52, flags: 0x0},
-	51:   {region: 0x164, script: 0x5, flags: 0x0},
-	52:   {region: 0x121, script: 0x5, flags: 0x0},
-	53:   {region: 0x164, script: 0x52, flags: 0x0},
-	54:   {region: 0x164, script: 0x52, flags: 0x0},
-	55:   {region: 0x164, script: 0x52, flags: 0x0},
-	56:   {region: 0x164, script: 0x52, flags: 0x0},
-	57:   {region: 0x6a, script: 0x5, flags: 0x0},
-	58:   {region: 0x0, script: 0x3, flags: 0x1},
-	59:   {region: 0x164, script: 0x52, flags: 0x0},
-	60:   {region: 0x50, script: 0x52, flags: 0x0},
-	61:   {region: 0x3e, script: 0x52, flags: 0x0},
-	62:   {region: 0x66, script: 0x5, flags: 0x0},
-	64:   {region: 0xb9, script: 0x5, flags: 0x0},
-	65:   {region: 0x6a, script: 0x5, flags: 0x0},
-	66:   {region: 0x98, script: 0xe, flags: 0x0},
-	67:   {region: 0x12e, script: 0x52, flags: 0x0},
-	68:   {region: 0x134, script: 0xbc, flags: 0x0},
-	69:   {region: 0x164, script: 0x52, flags: 0x0},
-	70:   {region: 0x164, script: 0x52, flags: 0x0},
-	71:   {region: 0x6d, script: 0x52, flags: 0x0},
-	72:   {region: 0x164, script: 0x52, flags: 0x0},
-	73:   {region: 0x164, script: 0x52, flags: 0x0},
-	74:   {region: 0x48, script: 0x52, flags: 0x0},
-	75:   {region: 0x164, script: 0x52, flags: 0x0},
-	76:   {region: 0x105, script: 0x1e, flags: 0x0},
-	77:   {region: 0x164, script: 0x5, flags: 0x0},
-	78:   {region: 0x164, script: 0x52, flags: 0x0},
-	79:   {region: 0x164, script: 0x52, flags: 0x0},
-	80:   {region: 0x164, script: 0x52, flags: 0x0},
-	81:   {region: 0x98, script: 0x20, flags: 0x0},
-	82:   {region: 0x164, script: 0x52, flags: 0x0},
-	83:   {region: 0x164, script: 0x52, flags: 0x0},
-	84:   {region: 0x164, script: 0x52, flags: 0x0},
-	85:   {region: 0x3e, script: 0x52, flags: 0x0},
-	86:   {region: 0x164, script: 0x52, flags: 0x0},
-	87:   {region: 0x3, script: 0x5, flags: 0x1},
-	88:   {region: 0x105, script: 0x1e, flags: 0x0},
-	89:   {region: 0xe7, script: 0x5, flags: 0x0},
-	90:   {region: 0x94, script: 0x52, flags: 0x0},
-	91:   {region: 0xda, script: 0x20, flags: 0x0},
-	92:   {region: 0x2d, script: 0x52, flags: 0x0},
-	93:   {region: 0x51, script: 0x52, flags: 0x0},
-	94:   {region: 0x164, script: 0x52, flags: 0x0},
-	95:   {region: 0x51, script: 0xb, flags: 0x0},
-	96:   {region: 0x164, script: 0x52, flags: 0x0},
-	97:   {region: 0x164, script: 0x52, flags: 0x0},
-	98:   {region: 0x94, script: 0x52, flags: 0x0},
-	99:   {region: 0x164, script: 0x52, flags: 0x0},
-	100:  {region: 0x51, script: 0x52, flags: 0x0},
-	101:  {region: 0x164, script: 0x52, flags: 0x0},
-	102:  {region: 0x164, script: 0x52, flags: 0x0},
-	103:  {region: 0x164, script: 0x52, flags: 0x0},
-	104:  {region: 0x164, script: 0x52, flags: 0x0},
-	105:  {region: 0x4e, script: 0x52, flags: 0x0},
-	106:  {region: 0x164, script: 0x52, flags: 0x0},
-	107:  {region: 0x164, script: 0x52, flags: 0x0},
-	108:  {region: 0x164, script: 0x52, flags: 0x0},
-	109:  {region: 0x164, script: 0x27, flags: 0x0},
-	110:  {region: 0x164, script: 0x52, flags: 0x0},
-	111:  {region: 0x164, script: 0x52, flags: 0x0},
-	112:  {region: 0x46, script: 0x1e, flags: 0x0},
-	113:  {region: 0x164, script: 0x52, flags: 0x0},
-	114:  {region: 0x164, script: 0x52, flags: 0x0},
-	115:  {region: 0x10a, script: 0x5, flags: 0x0},
-	116:  {region: 0x161, script: 0x52, flags: 0x0},
-	117:  {region: 0x164, script: 0x52, flags: 0x0},
-	118:  {region: 0x94, script: 0x52, flags: 0x0},
-	119:  {region: 0x164, script: 0x52, flags: 0x0},
-	120:  {region: 0x12e, script: 0x52, flags: 0x0},
-	121:  {region: 0x51, script: 0x52, flags: 0x0},
-	122:  {region: 0x98, script: 0xcd, flags: 0x0},
-	123:  {region: 0xe7, script: 0x5, flags: 0x0},
-	124:  {region: 0x98, script: 0x20, flags: 0x0},
-	125:  {region: 0x37, script: 0x1e, flags: 0x0},
-	126:  {region: 0x98, script: 0x20, flags: 0x0},
-	127:  {region: 0xe7, script: 0x5, flags: 0x0},
-	128:  {region: 0x12a, script: 0x2d, flags: 0x0},
-	130:  {region: 0x98, script: 0x20, flags: 0x0},
-	131:  {region: 0x164, script: 0x52, flags: 0x0},
-	132:  {region: 0x98, script: 0x20, flags: 0x0},
-	133:  {region: 0xe6, script: 0x52, flags: 0x0},
-	134:  {region: 0x164, script: 0x52, flags: 0x0},
-	135:  {region: 0x98, script: 0x20, flags: 0x0},
-	136:  {region: 0x164, script: 0x52, flags: 0x0},
-	137:  {region: 0x13e, script: 0x52, flags: 0x0},
-	138:  {region: 0x164, script: 0x52, flags: 0x0},
-	139:  {region: 0x164, script: 0x52, flags: 0x0},
-	140:  {region: 0xe6, script: 0x52, flags: 0x0},
-	141:  {region: 0x164, script: 0x52, flags: 0x0},
-	142:  {region: 0xd5, script: 0x52, flags: 0x0},
-	143:  {region: 0x164, script: 0x52, flags: 0x0},
-	144:  {region: 0x164, script: 0x52, flags: 0x0},
-	145:  {region: 0x164, script: 0x52, flags: 0x0},
-	146:  {region: 0x164, script: 0x27, flags: 0x0},
-	147:  {region: 0x98, script: 0x20, flags: 0x0},
-	148:  {region: 0x94, script: 0x52, flags: 0x0},
-	149:  {region: 0x164, script: 0x52, flags: 0x0},
-	150:  {region: 0x164, script: 0x52, flags: 0x0},
-	151:  {region: 0x164, script: 0x52, flags: 0x0},
-	152:  {region: 0x164, script: 0x52, flags: 0x0},
-	153:  {region: 0x51, script: 0x52, flags: 0x0},
-	154:  {region: 0x164, script: 0x52, flags: 0x0},
-	155:  {region: 0xe6, script: 0x52, flags: 0x0},
-	156:  {region: 0x164, script: 0x52, flags: 0x0},
-	157:  {region: 0x13d, script: 0xcf, flags: 0x0},
-	158:  {region: 0xc2, script: 0x52, flags: 0x0},
-	159:  {region: 0x164, script: 0x52, flags: 0x0},
-	160:  {region: 0x164, script: 0x52, flags: 0x0},
-	161:  {region: 0xc2, script: 0x52, flags: 0x0},
-	162:  {region: 0x164, script: 0x52, flags: 0x0},
-	163:  {region: 0x34, script: 0xe, flags: 0x0},
-	164:  {region: 0x164, script: 0x52, flags: 0x0},
-	165:  {region: 0x164, script: 0x52, flags: 0x0},
-	166:  {region: 0x164, script: 0x52, flags: 0x0},
-	167:  {region: 0x52, script: 0xd6, flags: 0x0},
-	168:  {region: 0x164, script: 0x52, flags: 0x0},
-	169:  {region: 0x164, script: 0x52, flags: 0x0},
-	170:  {region: 0x164, script: 0x52, flags: 0x0},
-	171:  {region: 0x98, script: 0xe, flags: 0x0},
-	172:  {region: 0x164, script: 0x52, flags: 0x0},
-	173:  {region: 0x9b, script: 0x5, flags: 0x0},
-	174:  {region: 0x164, script: 0x52, flags: 0x0},
-	175:  {region: 0x4e, script: 0x52, flags: 0x0},
-	176:  {region: 0x77, script: 0x52, flags: 0x0},
-	177:  {region: 0x98, script: 0x20, flags: 0x0},
-	178:  {region: 0xe7, script: 0x5, flags: 0x0},
-	179:  {region: 0x98, script: 0x20, flags: 0x0},
-	180:  {region: 0x164, script: 0x52, flags: 0x0},
-	181:  {region: 0x32, script: 0x52, flags: 0x0},
-	182:  {region: 0x164, script: 0x52, flags: 0x0},
-	183:  {region: 0xb3, script: 0xc, flags: 0x0},
-	184:  {region: 0x51, script: 0x52, flags: 0x0},
-	185:  {region: 0x164, script: 0x27, flags: 0x0},
-	186:  {region: 0xe6, script: 0x52, flags: 0x0},
-	187:  {region: 0x164, script: 0x52, flags: 0x0},
-	188:  {region: 0xe7, script: 0x20, flags: 0x0},
-	189:  {region: 0x105, script: 0x1e, flags: 0x0},
-	190:  {region: 0x15e, script: 0x52, flags: 0x0},
-	191:  {region: 0x164, script: 0x52, flags: 0x0},
-	192:  {region: 0x94, script: 0x52, flags: 0x0},
-	193:  {region: 0x164, script: 0x52, flags: 0x0},
-	194:  {region: 0x51, script: 0x52, flags: 0x0},
-	195:  {region: 0x164, script: 0x52, flags: 0x0},
-	196:  {region: 0x164, script: 0x52, flags: 0x0},
-	197:  {region: 0x164, script: 0x52, flags: 0x0},
-	198:  {region: 0x85, script: 0x52, flags: 0x0},
-	199:  {region: 0x164, script: 0x52, flags: 0x0},
-	200:  {region: 0x164, script: 0x52, flags: 0x0},
-	201:  {region: 0x164, script: 0x52, flags: 0x0},
-	202:  {region: 0x164, script: 0x52, flags: 0x0},
-	203:  {region: 0x6c, script: 0x27, flags: 0x0},
-	204:  {region: 0x164, script: 0x52, flags: 0x0},
-	205:  {region: 0x164, script: 0x52, flags: 0x0},
-	206:  {region: 0x51, script: 0x52, flags: 0x0},
-	207:  {region: 0x164, script: 0x52, flags: 0x0},
-	208:  {region: 0x164, script: 0x52, flags: 0x0},
-	209:  {region: 0xc2, script: 0x52, flags: 0x0},
-	210:  {region: 0x164, script: 0x52, flags: 0x0},
-	211:  {region: 0x164, script: 0x52, flags: 0x0},
-	212:  {region: 0x164, script: 0x52, flags: 0x0},
-	213:  {region: 0x6d, script: 0x52, flags: 0x0},
-	214:  {region: 0x164, script: 0x52, flags: 0x0},
-	215:  {region: 0x164, script: 0x52, flags: 0x0},
-	216:  {region: 0xd5, script: 0x52, flags: 0x0},
-	217:  {region: 0x8, script: 0x2, flags: 0x1},
-	218:  {region: 0x105, script: 0x1e, flags: 0x0},
-	219:  {region: 0xe6, script: 0x52, flags: 0x0},
-	220:  {region: 0x164, script: 0x52, flags: 0x0},
-	221:  {region: 0x130, script: 0x52, flags: 0x0},
-	222:  {region: 0x89, script: 0x52, flags: 0x0},
-	223:  {region: 0x74, script: 0x52, flags: 0x0},
-	224:  {region: 0x105, script: 0x1e, flags: 0x0},
-	225:  {region: 0x134, script: 0x52, flags: 0x0},
-	226:  {region: 0x48, script: 0x52, flags: 0x0},
-	227:  {region: 0x134, script: 0x1a, flags: 0x0},
-	228:  {region: 0xa5, script: 0x5, flags: 0x0},
-	229:  {region: 0x13d, script: 0x19, flags: 0x0},
-	230:  {region: 0x164, script: 0x52, flags: 0x0},
-	231:  {region: 0x9a, script: 0x5, flags: 0x0},
-	232:  {region: 0x164, script: 0x52, flags: 0x0},
-	233:  {region: 0x164, script: 0x52, flags: 0x0},
-	234:  {region: 0x164, script: 0x52, flags: 0x0},
-	235:  {region: 0x164, script: 0x52, flags: 0x0},
-	236:  {region: 0x164, script: 0x52, flags: 0x0},
-	237:  {region: 0x77, script: 0x52, flags: 0x0},
-	238:  {region: 0x6a, script: 0x1c, flags: 0x0},
-	239:  {region: 0xe6, script: 0x52, flags: 0x0},
-	240:  {region: 0x48, script: 0x17, flags: 0x0},
-	241:  {region: 0x48, script: 0x17, flags: 0x0},
-	242:  {region: 0x48, script: 0x17, flags: 0x0},
-	243:  {region: 0x48, script: 0x17, flags: 0x0},
-	244:  {region: 0x48, script: 0x17, flags: 0x0},
-	245:  {region: 0x109, script: 0x52, flags: 0x0},
-	246:  {region: 0x5d, script: 0x52, flags: 0x0},
-	247:  {region: 0xe8, script: 0x52, flags: 0x0},
-	248:  {region: 0x48, script: 0x17, flags: 0x0},
-	249:  {region: 0xc3, script: 0x79, flags: 0x0},
-	250:  {region: 0xa, script: 0x2, flags: 0x1},
-	251:  {region: 0x105, script: 0x1e, flags: 0x0},
-	252:  {region: 0x7a, script: 0x52, flags: 0x0},
-	253:  {region: 0x62, script: 0x52, flags: 0x0},
-	254:  {region: 0x164, script: 0x52, flags: 0x0},
-	255:  {region: 0x164, script: 0x52, flags: 0x0},
-	256:  {region: 0x164, script: 0x52, flags: 0x0},
-	257:  {region: 0x164, script: 0x52, flags: 0x0},
-	258:  {region: 0x134, script: 0x52, flags: 0x0},
-	259:  {region: 0x105, script: 0x1e, flags: 0x0},
-	260:  {region: 0xa3, script: 0x52, flags: 0x0},
-	261:  {region: 0x164, script: 0x52, flags: 0x0},
-	262:  {region: 0x164, script: 0x52, flags: 0x0},
-	263:  {region: 0x98, script: 0x5, flags: 0x0},
-	264:  {region: 0x164, script: 0x52, flags: 0x0},
-	265:  {region: 0x5f, script: 0x52, flags: 0x0},
-	266:  {region: 0x164, script: 0x52, flags: 0x0},
-	267:  {region: 0x48, script: 0x52, flags: 0x0},
-	268:  {region: 0x164, script: 0x52, flags: 0x0},
-	269:  {region: 0x164, script: 0x52, flags: 0x0},
-	270:  {region: 0x164, script: 0x52, flags: 0x0},
-	271:  {region: 0x164, script: 0x5, flags: 0x0},
-	272:  {region: 0x48, script: 0x52, flags: 0x0},
-	273:  {region: 0x164, script: 0x52, flags: 0x0},
-	274:  {region: 0x164, script: 0x52, flags: 0x0},
-	275:  {region: 0xd3, script: 0x52, flags: 0x0},
-	276:  {region: 0x4e, script: 0x52, flags: 0x0},
-	277:  {region: 0x164, script: 0x52, flags: 0x0},
-	278:  {region: 0x98, script: 0x5, flags: 0x0},
-	279:  {region: 0x164, script: 0x52, flags: 0x0},
-	280:  {region: 0x164, script: 0x52, flags: 0x0},
-	281:  {region: 0x164, script: 0x52, flags: 0x0},
-	282:  {region: 0x164, script: 0x27, flags: 0x0},
-	283:  {region: 0x5f, script: 0x52, flags: 0x0},
-	284:  {region: 0xc2, script: 0x52, flags: 0x0},
-	285:  {region: 0xcf, script: 0x52, flags: 0x0},
-	286:  {region: 0x164, script: 0x52, flags: 0x0},
-	287:  {region: 0xda, script: 0x20, flags: 0x0},
-	288:  {region: 0x51, script: 0x52, flags: 0x0},
-	289:  {region: 0x164, script: 0x52, flags: 0x0},
-	290:  {region: 0x164, script: 0x52, flags: 0x0},
-	291:  {region: 0x164, script: 0x52, flags: 0x0},
-	292:  {region: 0xcc, script: 0xd4, flags: 0x0},
-	293:  {region: 0x164, script: 0x52, flags: 0x0},
-	294:  {region: 0x164, script: 0x52, flags: 0x0},
-	295:  {region: 0x113, script: 0x52, flags: 0x0},
-	296:  {region: 0x36, script: 0x52, flags: 0x0},
-	297:  {region: 0x42, script: 0xd6, flags: 0x0},
-	298:  {region: 0x164, script: 0x52, flags: 0x0},
-	299:  {region: 0xa3, script: 0x52, flags: 0x0},
-	300:  {region: 0x7f, script: 0x52, flags: 0x0},
-	301:  {region: 0xd5, script: 0x52, flags: 0x0},
-	302:  {region: 0x9d, script: 0x52, flags: 0x0},
-	303:  {region: 0x6a, script: 0x25, flags: 0x0},
-	304:  {region: 0xc3, script: 0x43, flags: 0x0},
-	305:  {region: 0x86, script: 0x2d, flags: 0x0},
-	306:  {region: 0x164, script: 0x52, flags: 0x0},
-	307:  {region: 0x164, script: 0x52, flags: 0x0},
-	308:  {region: 0xc, script: 0x2, flags: 0x1},
-	309:  {region: 0x164, script: 0x52, flags: 0x0},
-	310:  {region: 0x164, script: 0x52, flags: 0x0},
-	311:  {region: 0x1, script: 0x52, flags: 0x0},
-	312:  {region: 0x164, script: 0x52, flags: 0x0},
-	313:  {region: 0x6d, script: 0x52, flags: 0x0},
-	314:  {region: 0x134, script: 0x52, flags: 0x0},
-	315:  {region: 0x69, script: 0x52, flags: 0x0},
-	316:  {region: 0x164, script: 0x52, flags: 0x0},
-	317:  {region: 0x9d, script: 0x3e, flags: 0x0},
-	318:  {region: 0x164, script: 0x52, flags: 0x0},
-	319:  {region: 0x164, script: 0x52, flags: 0x0},
-	320:  {region: 0x6d, script: 0x52, flags: 0x0},
-	321:  {region: 0x51, script: 0x52, flags: 0x0},
-	322:  {region: 0x6d, script: 0x52, flags: 0x0},
-	323:  {region: 0x9b, script: 0x5, flags: 0x0},
-	324:  {region: 0x164, script: 0x52, flags: 0x0},
-	325:  {region: 0x164, script: 0x52, flags: 0x0},
-	326:  {region: 0x164, script: 0x52, flags: 0x0},
-	327:  {region: 0x164, script: 0x52, flags: 0x0},
-	328:  {region: 0x85, script: 0x52, flags: 0x0},
-	329:  {region: 0xe, script: 0x2, flags: 0x1},
-	330:  {region: 0x164, script: 0x52, flags: 0x0},
-	331:  {region: 0xc2, script: 0x52, flags: 0x0},
-	332:  {region: 0x71, script: 0x52, flags: 0x0},
-	333:  {region: 0x10a, script: 0x5, flags: 0x0},
-	334:  {region: 0xe6, script: 0x52, flags: 0x0},
-	335:  {region: 0x10b, script: 0x52, flags: 0x0},
-	336:  {region: 0x72, script: 0x52, flags: 0x0},
-	337:  {region: 0x164, script: 0x52, flags: 0x0},
-	338:  {region: 0x164, script: 0x52, flags: 0x0},
-	339:  {region: 0x75, script: 0x52, flags: 0x0},
-	340:  {region: 0x164, script: 0x52, flags: 0x0},
-	341:  {region: 0x3a, script: 0x52, flags: 0x0},
-	342:  {region: 0x164, script: 0x52, flags: 0x0},
-	343:  {region: 0x164, script: 0x52, flags: 0x0},
-	344:  {region: 0x164, script: 0x52, flags: 0x0},
-	345:  {region: 0x77, script: 0x52, flags: 0x0},
-	346:  {region: 0x134, script: 0x52, flags: 0x0},
-	347:  {region: 0x77, script: 0x52, flags: 0x0},
-	348:  {region: 0x5f, script: 0x52, flags: 0x0},
-	349:  {region: 0x5f, script: 0x52, flags: 0x0},
-	350:  {region: 0x51, script: 0x5, flags: 0x0},
-	351:  {region: 0x13f, script: 0x52, flags: 0x0},
-	352:  {region: 0x164, script: 0x52, flags: 0x0},
-	353:  {region: 0x83, script: 0x52, flags: 0x0},
-	354:  {region: 0x164, script: 0x52, flags: 0x0},
-	355:  {region: 0xd3, script: 0x52, flags: 0x0},
-	356:  {region: 0x9d, script: 0x52, flags: 0x0},
-	357:  {region: 0xd5, script: 0x52, flags: 0x0},
-	358:  {region: 0x164, script: 0x52, flags: 0x0},
-	359:  {region: 0x10a, script: 0x52, flags: 0x0},
-	360:  {region: 0xd8, script: 0x52, flags: 0x0},
-	361:  {region: 0x95, script: 0x52, flags: 0x0},
-	362:  {region: 0x7f, script: 0x52, flags: 0x0},
-	363:  {region: 0x164, script: 0x52, flags: 0x0},
-	364:  {region: 0xbb, script: 0x52, flags: 0x0},
-	365:  {region: 0x164, script: 0x52, flags: 0x0},
-	366:  {region: 0x164, script: 0x52, flags: 0x0},
-	367:  {region: 0x164, script: 0x52, flags: 0x0},
-	368:  {region: 0x52, script: 0x34, flags: 0x0},
-	369:  {region: 0x164, script: 0x52, flags: 0x0},
-	370:  {region: 0x94, script: 0x52, flags: 0x0},
-	371:  {region: 0x164, script: 0x52, flags: 0x0},
-	372:  {region: 0x98, script: 0x20, flags: 0x0},
-	373:  {region: 0x164, script: 0x52, flags: 0x0},
-	374:  {region: 0x9b, script: 0x5, flags: 0x0},
-	375:  {region: 0x7d, script: 0x52, flags: 0x0},
-	376:  {region: 0x7a, script: 0x52, flags: 0x0},
-	377:  {region: 0x164, script: 0x52, flags: 0x0},
-	378:  {region: 0x164, script: 0x52, flags: 0x0},
-	379:  {region: 0x164, script: 0x52, flags: 0x0},
-	380:  {region: 0x164, script: 0x52, flags: 0x0},
-	381:  {region: 0x164, script: 0x52, flags: 0x0},
-	382:  {region: 0x164, script: 0x52, flags: 0x0},
-	383:  {region: 0x6e, script: 0x27, flags: 0x0},
-	384:  {region: 0x164, script: 0x52, flags: 0x0},
-	385:  {region: 0xda, script: 0x20, flags: 0x0},
-	386:  {region: 0x164, script: 0x52, flags: 0x0},
-	387:  {region: 0xa6, script: 0x52, flags: 0x0},
-	388:  {region: 0x164, script: 0x52, flags: 0x0},
-	389:  {region: 0xe7, script: 0x5, flags: 0x0},
-	390:  {region: 0x164, script: 0x52, flags: 0x0},
-	391:  {region: 0xe7, script: 0x5, flags: 0x0},
-	392:  {region: 0x164, script: 0x52, flags: 0x0},
-	393:  {region: 0x164, script: 0x52, flags: 0x0},
-	394:  {region: 0x6d, script: 0x52, flags: 0x0},
-	395:  {region: 0x9b, script: 0x5, flags: 0x0},
-	396:  {region: 0x164, script: 0x52, flags: 0x0},
-	397:  {region: 0x164, script: 0x27, flags: 0x0},
-	398:  {region: 0xf0, script: 0x52, flags: 0x0},
-	399:  {region: 0x164, script: 0x52, flags: 0x0},
-	400:  {region: 0x164, script: 0x52, flags: 0x0},
-	401:  {region: 0x164, script: 0x52, flags: 0x0},
-	402:  {region: 0x164, script: 0x27, flags: 0x0},
-	403:  {region: 0x164, script: 0x52, flags: 0x0},
-	404:  {region: 0x98, script: 0x20, flags: 0x0},
-	405:  {region: 0x98, script: 0xd0, flags: 0x0},
-	406:  {region: 0x94, script: 0x52, flags: 0x0},
-	407:  {region: 0xd8, script: 0x52, flags: 0x0},
-	408:  {region: 0x12f, script: 0x2b, flags: 0x0},
-	409:  {region: 0x10, script: 0x2, flags: 0x1},
-	410:  {region: 0x98, script: 0xe, flags: 0x0},
-	411:  {region: 0x164, script: 0x52, flags: 0x0},
-	412:  {region: 0x4d, script: 0x52, flags: 0x0},
-	413:  {region: 0x98, script: 0x2e, flags: 0x0},
-	414:  {region: 0x40, script: 0x52, flags: 0x0},
-	415:  {region: 0x53, script: 0x52, flags: 0x0},
-	416:  {region: 0x164, script: 0x52, flags: 0x0},
-	417:  {region: 0x7f, script: 0x52, flags: 0x0},
-	418:  {region: 0x164, script: 0x52, flags: 0x0},
-	419:  {region: 0x164, script: 0x52, flags: 0x0},
-	420:  {region: 0xa3, script: 0x52, flags: 0x0},
-	421:  {region: 0x97, script: 0x52, flags: 0x0},
-	422:  {region: 0x164, script: 0x52, flags: 0x0},
-	423:  {region: 0xda, script: 0x20, flags: 0x0},
-	424:  {region: 0x164, script: 0x52, flags: 0x0},
-	425:  {region: 0x164, script: 0x5, flags: 0x0},
-	426:  {region: 0x48, script: 0x52, flags: 0x0},
-	427:  {region: 0x164, script: 0x5, flags: 0x0},
-	428:  {region: 0x164, script: 0x52, flags: 0x0},
-	429:  {region: 0x12, script: 0x3, flags: 0x1},
-	430:  {region: 0x164, script: 0x52, flags: 0x0},
-	431:  {region: 0x52, script: 0x34, flags: 0x0},
-	432:  {region: 0x164, script: 0x52, flags: 0x0},
-	433:  {region: 0x134, script: 0x52, flags: 0x0},
-	434:  {region: 0x23, script: 0x5, flags: 0x0},
-	435:  {region: 0x164, script: 0x52, flags: 0x0},
-	436:  {region: 0x164, script: 0x27, flags: 0x0},
-	437:  {region: 0x96, script: 0x37, flags: 0x0},
-	438:  {region: 0x164, script: 0x52, flags: 0x0},
-	439:  {region: 0x98, script: 0x20, flags: 0x0},
-	440:  {region: 0x164, script: 0x52, flags: 0x0},
-	441:  {region: 0x72, script: 0x52, flags: 0x0},
-	442:  {region: 0x164, script: 0x52, flags: 0x0},
-	443:  {region: 0x164, script: 0x52, flags: 0x0},
-	444:  {region: 0xe6, script: 0x52, flags: 0x0},
-	445:  {region: 0x164, script: 0x52, flags: 0x0},
-	446:  {region: 0x12a, script: 0x39, flags: 0x0},
-	447:  {region: 0x52, script: 0x81, flags: 0x0},
-	448:  {region: 0x164, script: 0x52, flags: 0x0},
-	449:  {region: 0xe7, script: 0x5, flags: 0x0},
-	450:  {region: 0x98, script: 0x20, flags: 0x0},
-	451:  {region: 0xae, script: 0x3a, flags: 0x0},
-	452:  {region: 0xe6, script: 0x52, flags: 0x0},
-	453:  {region: 0xe7, script: 0x5, flags: 0x0},
-	454:  {region: 0xe5, script: 0x52, flags: 0x0},
-	455:  {region: 0x98, script: 0x20, flags: 0x0},
-	456:  {region: 0x98, script: 0x20, flags: 0x0},
-	457:  {region: 0x164, script: 0x52, flags: 0x0},
-	458:  {region: 0x8f, script: 0x52, flags: 0x0},
-	459:  {region: 0x5f, script: 0x52, flags: 0x0},
-	460:  {region: 0x52, script: 0x34, flags: 0x0},
-	461:  {region: 0x90, script: 0x52, flags: 0x0},
-	462:  {region: 0x91, script: 0x52, flags: 0x0},
-	463:  {region: 0x164, script: 0x52, flags: 0x0},
-	464:  {region: 0x27, script: 0x8, flags: 0x0},
-	465:  {region: 0xd1, script: 0x52, flags: 0x0},
-	466:  {region: 0x77, script: 0x52, flags: 0x0},
-	467:  {region: 0x164, script: 0x52, flags: 0x0},
-	468:  {region: 0x164, script: 0x52, flags: 0x0},
-	469:  {region: 0xcf, script: 0x52, flags: 0x0},
-	470:  {region: 0xd5, script: 0x52, flags: 0x0},
-	471:  {region: 0x164, script: 0x52, flags: 0x0},
-	472:  {region: 0x164, script: 0x52, flags: 0x0},
-	473:  {region: 0x164, script: 0x52, flags: 0x0},
-	474:  {region: 0x94, script: 0x52, flags: 0x0},
-	475:  {region: 0x164, script: 0x52, flags: 0x0},
-	476:  {region: 0x164, script: 0x52, flags: 0x0},
-	477:  {region: 0x164, script: 0x52, flags: 0x0},
-	479:  {region: 0xd5, script: 0x52, flags: 0x0},
-	480:  {region: 0x164, script: 0x52, flags: 0x0},
-	481:  {region: 0x164, script: 0x52, flags: 0x0},
-	482:  {region: 0x52, script: 0xdf, flags: 0x0},
-	483:  {region: 0x164, script: 0x52, flags: 0x0},
-	484:  {region: 0x134, script: 0x52, flags: 0x0},
-	485:  {region: 0x164, script: 0x52, flags: 0x0},
-	486:  {region: 0x48, script: 0x52, flags: 0x0},
-	487:  {region: 0x164, script: 0x52, flags: 0x0},
-	488:  {region: 0x164, script: 0x52, flags: 0x0},
-	489:  {region: 0xe6, script: 0x52, flags: 0x0},
-	490:  {region: 0x164, script: 0x52, flags: 0x0},
-	491:  {region: 0x94, script: 0x52, flags: 0x0},
-	492:  {region: 0x105, script: 0x1e, flags: 0x0},
-	494:  {region: 0x164, script: 0x52, flags: 0x0},
-	495:  {region: 0x164, script: 0x52, flags: 0x0},
-	496:  {region: 0x9c, script: 0x52, flags: 0x0},
-	497:  {region: 0x9d, script: 0x52, flags: 0x0},
-	498:  {region: 0x48, script: 0x17, flags: 0x0},
-	499:  {region: 0x96, script: 0x37, flags: 0x0},
-	500:  {region: 0x164, script: 0x52, flags: 0x0},
-	501:  {region: 0x164, script: 0x52, flags: 0x0},
-	502:  {region: 0x105, script: 0x52, flags: 0x0},
-	503:  {region: 0x164, script: 0x52, flags: 0x0},
-	504:  {region: 0xa1, script: 0x41, flags: 0x0},
-	505:  {region: 0x164, script: 0x52, flags: 0x0},
-	506:  {region: 0x9f, script: 0x52, flags: 0x0},
-	508:  {region: 0x164, script: 0x52, flags: 0x0},
-	509:  {region: 0x164, script: 0x52, flags: 0x0},
-	510:  {region: 0x164, script: 0x52, flags: 0x0},
-	511:  {region: 0x51, script: 0x52, flags: 0x0},
-	512:  {region: 0x12f, script: 0x37, flags: 0x0},
-	513:  {region: 0x164, script: 0x52, flags: 0x0},
-	514:  {region: 0x12e, script: 0x52, flags: 0x0},
-	515:  {region: 0xda, script: 0x20, flags: 0x0},
-	516:  {region: 0x164, script: 0x52, flags: 0x0},
-	517:  {region: 0x62, script: 0x52, flags: 0x0},
-	518:  {region: 0x94, script: 0x52, flags: 0x0},
-	519:  {region: 0x94, script: 0x52, flags: 0x0},
-	520:  {region: 0x7c, script: 0x29, flags: 0x0},
-	521:  {region: 0x136, script: 0x1e, flags: 0x0},
-	522:  {region: 0x66, script: 0x52, flags: 0x0},
-	523:  {region: 0xc3, script: 0x52, flags: 0x0},
-	524:  {region: 0x164, script: 0x52, flags: 0x0},
-	525:  {region: 0x164, script: 0x52, flags: 0x0},
-	526:  {region: 0xd5, script: 0x52, flags: 0x0},
-	527:  {region: 0xa3, script: 0x52, flags: 0x0},
-	528:  {region: 0xc2, script: 0x52, flags: 0x0},
-	529:  {region: 0x105, script: 0x1e, flags: 0x0},
-	530:  {region: 0x164, script: 0x52, flags: 0x0},
-	531:  {region: 0x164, script: 0x52, flags: 0x0},
-	532:  {region: 0x164, script: 0x52, flags: 0x0},
-	533:  {region: 0x164, script: 0x52, flags: 0x0},
-	534:  {region: 0xd3, script: 0x5, flags: 0x0},
-	535:  {region: 0xd5, script: 0x52, flags: 0x0},
-	536:  {region: 0x163, script: 0x52, flags: 0x0},
-	537:  {region: 0x164, script: 0x52, flags: 0x0},
-	538:  {region: 0x164, script: 0x52, flags: 0x0},
-	539:  {region: 0x12e, script: 0x52, flags: 0x0},
-	540:  {region: 0x121, script: 0x5, flags: 0x0},
-	541:  {region: 0x164, script: 0x52, flags: 0x0},
-	542:  {region: 0x122, script: 0xd5, flags: 0x0},
-	543:  {region: 0x59, script: 0x52, flags: 0x0},
-	544:  {region: 0x51, script: 0x52, flags: 0x0},
-	545:  {region: 0x164, script: 0x52, flags: 0x0},
-	546:  {region: 0x4e, script: 0x52, flags: 0x0},
-	547:  {region: 0x98, script: 0x20, flags: 0x0},
-	548:  {region: 0x98, script: 0x20, flags: 0x0},
-	549:  {region: 0x4a, script: 0x52, flags: 0x0},
-	550:  {region: 0x94, script: 0x52, flags: 0x0},
-	551:  {region: 0x164, script: 0x52, flags: 0x0},
-	552:  {region: 0x40, script: 0x52, flags: 0x0},
-	553:  {region: 0x98, script: 0x52, flags: 0x0},
-	554:  {region: 0x52, script: 0xcc, flags: 0x0},
-	555:  {region: 0x98, script: 0x20, flags: 0x0},
-	556:  {region: 0xc2, script: 0x52, flags: 0x0},
-	557:  {region: 0x164, script: 0x52, flags: 0x0},
-	558:  {region: 0x98, script: 0x6b, flags: 0x0},
-	559:  {region: 0xe7, script: 0x5, flags: 0x0},
-	560:  {region: 0x164, script: 0x52, flags: 0x0},
-	561:  {region: 0xa3, script: 0x52, flags: 0x0},
-	562:  {region: 0x164, script: 0x52, flags: 0x0},
-	563:  {region: 0x12a, script: 0x52, flags: 0x0},
-	564:  {region: 0x164, script: 0x52, flags: 0x0},
-	565:  {region: 0xd1, script: 0x52, flags: 0x0},
-	566:  {region: 0x164, script: 0x52, flags: 0x0},
-	567:  {region: 0xae, script: 0x4f, flags: 0x0},
-	568:  {region: 0x164, script: 0x52, flags: 0x0},
-	569:  {region: 0x164, script: 0x52, flags: 0x0},
-	570:  {region: 0x15, script: 0x6, flags: 0x1},
-	571:  {region: 0x164, script: 0x52, flags: 0x0},
-	572:  {region: 0x51, script: 0x52, flags: 0x0},
-	573:  {region: 0x81, script: 0x52, flags: 0x0},
-	574:  {region: 0xa3, script: 0x52, flags: 0x0},
-	575:  {region: 0x164, script: 0x52, flags: 0x0},
-	576:  {region: 0x164, script: 0x52, flags: 0x0},
-	577:  {region: 0x164, script: 0x52, flags: 0x0},
-	578:  {region: 0xa5, script: 0x46, flags: 0x0},
-	579:  {region: 0x29, script: 0x52, flags: 0x0},
-	580:  {region: 0x164, script: 0x52, flags: 0x0},
-	581:  {region: 0x164, script: 0x52, flags: 0x0},
-	582:  {region: 0x164, script: 0x52, flags: 0x0},
-	583:  {region: 0x164, script: 0x52, flags: 0x0},
-	584:  {region: 0x164, script: 0x52, flags: 0x0},
-	585:  {region: 0x98, script: 0x4a, flags: 0x0},
-	586:  {region: 0x164, script: 0x52, flags: 0x0},
-	587:  {region: 0xaa, script: 0x4b, flags: 0x0},
-	588:  {region: 0x105, script: 0x1e, flags: 0x0},
-	589:  {region: 0x98, script: 0x20, flags: 0x0},
-	590:  {region: 0x164, script: 0x52, flags: 0x0},
-	591:  {region: 0x74, script: 0x52, flags: 0x0},
-	592:  {region: 0x164, script: 0x52, flags: 0x0},
-	593:  {region: 0xb3, script: 0x52, flags: 0x0},
-	594:  {region: 0x164, script: 0x52, flags: 0x0},
-	595:  {region: 0x164, script: 0x52, flags: 0x0},
-	596:  {region: 0x164, script: 0x52, flags: 0x0},
-	597:  {region: 0x164, script: 0x52, flags: 0x0},
-	598:  {region: 0x164, script: 0x52, flags: 0x0},
-	599:  {region: 0x164, script: 0x52, flags: 0x0},
-	600:  {region: 0x164, script: 0x52, flags: 0x0},
-	601:  {region: 0x164, script: 0x27, flags: 0x0},
-	603:  {region: 0x105, script: 0x1e, flags: 0x0},
-	604:  {region: 0x111, script: 0x52, flags: 0x0},
-	605:  {region: 0xe6, script: 0x52, flags: 0x0},
-	606:  {region: 0x105, script: 0x52, flags: 0x0},
-	607:  {region: 0x164, script: 0x52, flags: 0x0},
-	608:  {region: 0x98, script: 0x20, flags: 0x0},
-	609:  {region: 0x98, script: 0x5, flags: 0x0},
-	610:  {region: 0x12e, script: 0x52, flags: 0x0},
-	611:  {region: 0x164, script: 0x52, flags: 0x0},
-	612:  {region: 0x51, script: 0x52, flags: 0x0},
-	613:  {region: 0x5f, script: 0x52, flags: 0x0},
-	614:  {region: 0x164, script: 0x52, flags: 0x0},
-	615:  {region: 0x164, script: 0x52, flags: 0x0},
-	616:  {region: 0x164, script: 0x27, flags: 0x0},
-	617:  {region: 0x164, script: 0x52, flags: 0x0},
-	618:  {region: 0x164, script: 0x52, flags: 0x0},
-	619:  {region: 0x1b, script: 0x3, flags: 0x1},
-	620:  {region: 0x164, script: 0x52, flags: 0x0},
-	621:  {region: 0x164, script: 0x52, flags: 0x0},
-	622:  {region: 0x164, script: 0x52, flags: 0x0},
-	623:  {region: 0x164, script: 0x52, flags: 0x0},
-	624:  {region: 0x105, script: 0x1e, flags: 0x0},
-	625:  {region: 0x164, script: 0x52, flags: 0x0},
-	626:  {region: 0x164, script: 0x52, flags: 0x0},
-	627:  {region: 0x164, script: 0x52, flags: 0x0},
-	628:  {region: 0x105, script: 0x1e, flags: 0x0},
-	629:  {region: 0x164, script: 0x52, flags: 0x0},
-	630:  {region: 0x94, script: 0x52, flags: 0x0},
-	631:  {region: 0xe7, script: 0x5, flags: 0x0},
-	632:  {region: 0x7a, script: 0x52, flags: 0x0},
-	633:  {region: 0x164, script: 0x52, flags: 0x0},
-	634:  {region: 0x164, script: 0x52, flags: 0x0},
-	635:  {region: 0x164, script: 0x52, flags: 0x0},
-	636:  {region: 0x164, script: 0x27, flags: 0x0},
-	637:  {region: 0x122, script: 0xd5, flags: 0x0},
-	638:  {region: 0xe7, script: 0x5, flags: 0x0},
-	639:  {region: 0x164, script: 0x52, flags: 0x0},
-	640:  {region: 0x164, script: 0x52, flags: 0x0},
-	641:  {region: 0x1e, script: 0x5, flags: 0x1},
-	642:  {region: 0x164, script: 0x52, flags: 0x0},
-	643:  {region: 0x164, script: 0x52, flags: 0x0},
-	644:  {region: 0x164, script: 0x52, flags: 0x0},
-	645:  {region: 0x137, script: 0x52, flags: 0x0},
-	646:  {region: 0x86, script: 0x56, flags: 0x0},
-	647:  {region: 0x96, script: 0x37, flags: 0x0},
-	648:  {region: 0x12e, script: 0x52, flags: 0x0},
-	649:  {region: 0xe7, script: 0x5, flags: 0x0},
-	650:  {region: 0x130, script: 0x52, flags: 0x0},
-	651:  {region: 0x164, script: 0x52, flags: 0x0},
-	652:  {region: 0xb6, script: 0x52, flags: 0x0},
-	653:  {region: 0x105, script: 0x1e, flags: 0x0},
-	654:  {region: 0x164, script: 0x52, flags: 0x0},
-	655:  {region: 0x94, script: 0x52, flags: 0x0},
-	656:  {region: 0x164, script: 0x52, flags: 0x0},
-	657:  {region: 0x52, script: 0xd5, flags: 0x0},
-	658:  {region: 0x164, script: 0x52, flags: 0x0},
-	659:  {region: 0x164, script: 0x52, flags: 0x0},
-	660:  {region: 0x164, script: 0x52, flags: 0x0},
-	661:  {region: 0x164, script: 0x52, flags: 0x0},
-	662:  {region: 0x98, script: 0x54, flags: 0x0},
-	663:  {region: 0x164, script: 0x52, flags: 0x0},
-	664:  {region: 0x164, script: 0x52, flags: 0x0},
-	665:  {region: 0x105, script: 0x1e, flags: 0x0},
-	666:  {region: 0x130, script: 0x52, flags: 0x0},
-	667:  {region: 0x164, script: 0x52, flags: 0x0},
-	668:  {region: 0xd8, script: 0x52, flags: 0x0},
-	669:  {region: 0x164, script: 0x52, flags: 0x0},
-	670:  {region: 0x164, script: 0x52, flags: 0x0},
-	671:  {region: 0x23, script: 0x2, flags: 0x1},
-	672:  {region: 0x164, script: 0x52, flags: 0x0},
-	673:  {region: 0x164, script: 0x52, flags: 0x0},
-	674:  {region: 0x9d, script: 0x52, flags: 0x0},
-	675:  {region: 0x52, script: 0x58, flags: 0x0},
-	676:  {region: 0x94, script: 0x52, flags: 0x0},
-	677:  {region: 0x9b, script: 0x5, flags: 0x0},
-	678:  {region: 0x134, script: 0x52, flags: 0x0},
-	679:  {region: 0x164, script: 0x52, flags: 0x0},
-	680:  {region: 0x164, script: 0x52, flags: 0x0},
-	681:  {region: 0x98, script: 0xd0, flags: 0x0},
-	682:  {region: 0x9d, script: 0x52, flags: 0x0},
-	683:  {region: 0x164, script: 0x52, flags: 0x0},
-	684:  {region: 0x4a, script: 0x52, flags: 0x0},
-	685:  {region: 0x164, script: 0x52, flags: 0x0},
-	686:  {region: 0x164, script: 0x52, flags: 0x0},
-	687:  {region: 0xae, script: 0x4f, flags: 0x0},
-	688:  {region: 0x164, script: 0x52, flags: 0x0},
-	689:  {region: 0x164, script: 0x52, flags: 0x0},
-	690:  {region: 0x4a, script: 0x52, flags: 0x0},
-	691:  {region: 0x164, script: 0x52, flags: 0x0},
-	692:  {region: 0x164, script: 0x52, flags: 0x0},
-	693:  {region: 0x161, script: 0x52, flags: 0x0},
-	694:  {region: 0x9b, script: 0x5, flags: 0x0},
-	695:  {region: 0xb5, script: 0x52, flags: 0x0},
-	696:  {region: 0xb7, script: 0x52, flags: 0x0},
-	697:  {region: 0x4a, script: 0x52, flags: 0x0},
-	698:  {region: 0x4a, script: 0x52, flags: 0x0},
-	699:  {region: 0xa3, script: 0x52, flags: 0x0},
-	700:  {region: 0xa3, script: 0x52, flags: 0x0},
-	701:  {region: 0x9b, script: 0x5, flags: 0x0},
-	702:  {region: 0xb7, script: 0x52, flags: 0x0},
-	703:  {region: 0x122, script: 0xd5, flags: 0x0},
-	704:  {region: 0x52, script: 0x34, flags: 0x0},
-	705:  {region: 0x12a, script: 0x52, flags: 0x0},
-	706:  {region: 0x94, script: 0x52, flags: 0x0},
-	707:  {region: 0x51, script: 0x52, flags: 0x0},
-	708:  {region: 0x98, script: 0x20, flags: 0x0},
-	709:  {region: 0x98, script: 0x20, flags: 0x0},
-	710:  {region: 0x94, script: 0x52, flags: 0x0},
-	711:  {region: 0x25, script: 0x3, flags: 0x1},
-	712:  {region: 0xa3, script: 0x52, flags: 0x0},
-	713:  {region: 0x164, script: 0x52, flags: 0x0},
-	714:  {region: 0xce, script: 0x52, flags: 0x0},
-	715:  {region: 0x164, script: 0x52, flags: 0x0},
-	716:  {region: 0x164, script: 0x52, flags: 0x0},
-	717:  {region: 0x164, script: 0x52, flags: 0x0},
-	718:  {region: 0x164, script: 0x52, flags: 0x0},
-	719:  {region: 0x164, script: 0x52, flags: 0x0},
-	720:  {region: 0x164, script: 0x52, flags: 0x0},
-	721:  {region: 0x164, script: 0x52, flags: 0x0},
-	722:  {region: 0x164, script: 0x52, flags: 0x0},
-	723:  {region: 0x164, script: 0x52, flags: 0x0},
-	724:  {region: 0x164, script: 0x52, flags: 0x0},
-	725:  {region: 0x164, script: 0x52, flags: 0x0},
-	726:  {region: 0x164, script: 0x5, flags: 0x0},
-	727:  {region: 0x105, script: 0x1e, flags: 0x0},
-	728:  {region: 0xe6, script: 0x52, flags: 0x0},
-	729:  {region: 0x164, script: 0x52, flags: 0x0},
-	730:  {region: 0x94, script: 0x52, flags: 0x0},
-	731:  {region: 0x164, script: 0x27, flags: 0x0},
-	732:  {region: 0x164, script: 0x52, flags: 0x0},
-	733:  {region: 0x164, script: 0x52, flags: 0x0},
-	734:  {region: 0x164, script: 0x52, flags: 0x0},
-	735:  {region: 0x111, script: 0x52, flags: 0x0},
-	736:  {region: 0xa3, script: 0x52, flags: 0x0},
-	737:  {region: 0x164, script: 0x52, flags: 0x0},
-	738:  {region: 0x164, script: 0x52, flags: 0x0},
-	739:  {region: 0x122, script: 0x5, flags: 0x0},
-	740:  {region: 0xcb, script: 0x52, flags: 0x0},
-	741:  {region: 0x164, script: 0x52, flags: 0x0},
-	742:  {region: 0x164, script: 0x52, flags: 0x0},
-	743:  {region: 0x164, script: 0x52, flags: 0x0},
-	744:  {region: 0xbe, script: 0x52, flags: 0x0},
-	745:  {region: 0xd0, script: 0x52, flags: 0x0},
-	746:  {region: 0x164, script: 0x52, flags: 0x0},
-	747:  {region: 0x51, script: 0x52, flags: 0x0},
-	748:  {region: 0xda, script: 0x20, flags: 0x0},
-	749:  {region: 0x12e, script: 0x52, flags: 0x0},
-	750:  {region: 0xbf, script: 0x52, flags: 0x0},
-	751:  {region: 0x164, script: 0x52, flags: 0x0},
-	752:  {region: 0x164, script: 0x52, flags: 0x0},
-	753:  {region: 0xdf, script: 0x52, flags: 0x0},
-	754:  {region: 0x164, script: 0x52, flags: 0x0},
-	755:  {region: 0x94, script: 0x52, flags: 0x0},
-	756:  {region: 0x9a, script: 0x36, flags: 0x0},
-	757:  {region: 0x164, script: 0x52, flags: 0x0},
-	758:  {region: 0xc1, script: 0x1e, flags: 0x0},
-	759:  {region: 0x164, script: 0x5, flags: 0x0},
-	760:  {region: 0x164, script: 0x52, flags: 0x0},
-	761:  {region: 0x164, script: 0x52, flags: 0x0},
-	762:  {region: 0x164, script: 0x52, flags: 0x0},
-	763:  {region: 0x98, script: 0x64, flags: 0x0},
-	764:  {region: 0x164, script: 0x52, flags: 0x0},
-	765:  {region: 0x164, script: 0x52, flags: 0x0},
-	766:  {region: 0x10a, script: 0x52, flags: 0x0},
-	767:  {region: 0x164, script: 0x52, flags: 0x0},
-	768:  {region: 0x164, script: 0x52, flags: 0x0},
-	769:  {region: 0x164, script: 0x52, flags: 0x0},
-	770:  {region: 0x28, script: 0x3, flags: 0x1},
-	771:  {region: 0x164, script: 0x52, flags: 0x0},
-	772:  {region: 0x164, script: 0x52, flags: 0x0},
-	773:  {region: 0x98, script: 0xe, flags: 0x0},
-	774:  {region: 0xc3, script: 0x6b, flags: 0x0},
-	776:  {region: 0x164, script: 0x52, flags: 0x0},
-	777:  {region: 0x48, script: 0x52, flags: 0x0},
-	778:  {region: 0x48, script: 0x52, flags: 0x0},
-	779:  {region: 0x36, script: 0x52, flags: 0x0},
-	780:  {region: 0x164, script: 0x52, flags: 0x0},
-	781:  {region: 0x164, script: 0x52, flags: 0x0},
-	782:  {region: 0x164, script: 0x52, flags: 0x0},
-	783:  {region: 0x164, script: 0x52, flags: 0x0},
-	784:  {region: 0x164, script: 0x52, flags: 0x0},
-	785:  {region: 0x164, script: 0x52, flags: 0x0},
-	786:  {region: 0x98, script: 0x20, flags: 0x0},
-	787:  {region: 0xda, script: 0x20, flags: 0x0},
-	788:  {region: 0x105, script: 0x1e, flags: 0x0},
-	789:  {region: 0x34, script: 0x68, flags: 0x0},
-	790:  {region: 0x2b, script: 0x3, flags: 0x1},
-	791:  {region: 0xca, script: 0x52, flags: 0x0},
-	792:  {region: 0x164, script: 0x52, flags: 0x0},
-	793:  {region: 0x164, script: 0x52, flags: 0x0},
-	794:  {region: 0x164, script: 0x52, flags: 0x0},
-	795:  {region: 0x98, script: 0x20, flags: 0x0},
-	796:  {region: 0x51, script: 0x52, flags: 0x0},
-	798:  {region: 0x164, script: 0x52, flags: 0x0},
-	799:  {region: 0x134, script: 0x52, flags: 0x0},
-	800:  {region: 0x164, script: 0x52, flags: 0x0},
-	801:  {region: 0x164, script: 0x52, flags: 0x0},
-	802:  {region: 0xe7, script: 0x5, flags: 0x0},
-	803:  {region: 0xc2, script: 0x52, flags: 0x0},
-	804:  {region: 0x98, script: 0x20, flags: 0x0},
-	805:  {region: 0x94, script: 0x52, flags: 0x0},
-	806:  {region: 0x163, script: 0x52, flags: 0x0},
-	807:  {region: 0x164, script: 0x52, flags: 0x0},
-	808:  {region: 0xc3, script: 0x6b, flags: 0x0},
-	809:  {region: 0x164, script: 0x52, flags: 0x0},
-	810:  {region: 0x164, script: 0x27, flags: 0x0},
-	811:  {region: 0x105, script: 0x1e, flags: 0x0},
-	812:  {region: 0x164, script: 0x52, flags: 0x0},
-	813:  {region: 0x130, script: 0x52, flags: 0x0},
-	814:  {region: 0x9b, script: 0x5d, flags: 0x0},
-	815:  {region: 0x164, script: 0x52, flags: 0x0},
-	816:  {region: 0x164, script: 0x52, flags: 0x0},
-	817:  {region: 0x9b, script: 0x5, flags: 0x0},
-	818:  {region: 0x164, script: 0x52, flags: 0x0},
-	819:  {region: 0x164, script: 0x52, flags: 0x0},
-	820:  {region: 0x164, script: 0x52, flags: 0x0},
-	821:  {region: 0xdc, script: 0x52, flags: 0x0},
-	822:  {region: 0x164, script: 0x52, flags: 0x0},
-	823:  {region: 0x164, script: 0x52, flags: 0x0},
-	825:  {region: 0x164, script: 0x52, flags: 0x0},
-	826:  {region: 0x52, script: 0x34, flags: 0x0},
-	827:  {region: 0x9d, script: 0x52, flags: 0x0},
-	828:  {region: 0xd1, script: 0x52, flags: 0x0},
-	829:  {region: 0x164, script: 0x52, flags: 0x0},
-	830:  {region: 0xd9, script: 0x52, flags: 0x0},
-	831:  {region: 0x164, script: 0x52, flags: 0x0},
-	832:  {region: 0x164, script: 0x52, flags: 0x0},
-	833:  {region: 0x164, script: 0x52, flags: 0x0},
-	834:  {region: 0xce, script: 0x52, flags: 0x0},
-	835:  {region: 0x164, script: 0x52, flags: 0x0},
-	836:  {region: 0x164, script: 0x52, flags: 0x0},
-	837:  {region: 0x163, script: 0x52, flags: 0x0},
-	838:  {region: 0xd0, script: 0x52, flags: 0x0},
-	839:  {region: 0x5f, script: 0x52, flags: 0x0},
-	840:  {region: 0xda, script: 0x20, flags: 0x0},
-	841:  {region: 0x164, script: 0x52, flags: 0x0},
-	842:  {region: 0xda, script: 0x20, flags: 0x0},
-	843:  {region: 0x164, script: 0x52, flags: 0x0},
-	844:  {region: 0x164, script: 0x52, flags: 0x0},
-	845:  {region: 0xd1, script: 0x52, flags: 0x0},
-	846:  {region: 0x164, script: 0x52, flags: 0x0},
-	847:  {region: 0x164, script: 0x52, flags: 0x0},
-	848:  {region: 0xd0, script: 0x52, flags: 0x0},
-	849:  {region: 0x164, script: 0x52, flags: 0x0},
-	850:  {region: 0xce, script: 0x52, flags: 0x0},
-	851:  {region: 0xce, script: 0x52, flags: 0x0},
-	852:  {region: 0x164, script: 0x52, flags: 0x0},
-	853:  {region: 0x164, script: 0x52, flags: 0x0},
-	854:  {region: 0x94, script: 0x52, flags: 0x0},
-	855:  {region: 0x164, script: 0x52, flags: 0x0},
-	856:  {region: 0xde, script: 0x52, flags: 0x0},
-	857:  {region: 0x164, script: 0x52, flags: 0x0},
-	858:  {region: 0x164, script: 0x52, flags: 0x0},
-	859:  {region: 0x98, script: 0x52, flags: 0x0},
-	860:  {region: 0x164, script: 0x52, flags: 0x0},
-	861:  {region: 0x164, script: 0x52, flags: 0x0},
-	862:  {region: 0xd8, script: 0x52, flags: 0x0},
-	863:  {region: 0x51, script: 0x52, flags: 0x0},
-	864:  {region: 0x164, script: 0x52, flags: 0x0},
-	865:  {region: 0xd9, script: 0x52, flags: 0x0},
-	866:  {region: 0x164, script: 0x52, flags: 0x0},
-	867:  {region: 0x51, script: 0x52, flags: 0x0},
-	868:  {region: 0x164, script: 0x52, flags: 0x0},
-	869:  {region: 0x164, script: 0x52, flags: 0x0},
-	870:  {region: 0xd9, script: 0x52, flags: 0x0},
-	871:  {region: 0x122, script: 0x4e, flags: 0x0},
-	872:  {region: 0x98, script: 0x20, flags: 0x0},
-	873:  {region: 0x10b, script: 0xb7, flags: 0x0},
-	874:  {region: 0x164, script: 0x52, flags: 0x0},
-	875:  {region: 0x164, script: 0x52, flags: 0x0},
-	876:  {region: 0x83, script: 0x70, flags: 0x0},
-	877:  {region: 0x160, script: 0x52, flags: 0x0},
-	878:  {region: 0x164, script: 0x52, flags: 0x0},
-	879:  {region: 0x48, script: 0x17, flags: 0x0},
-	880:  {region: 0x164, script: 0x52, flags: 0x0},
-	881:  {region: 0x160, script: 0x52, flags: 0x0},
-	882:  {region: 0x164, script: 0x52, flags: 0x0},
-	883:  {region: 0x164, script: 0x52, flags: 0x0},
-	884:  {region: 0x164, script: 0x52, flags: 0x0},
-	885:  {region: 0x164, script: 0x52, flags: 0x0},
-	886:  {region: 0x164, script: 0x52, flags: 0x0},
-	887:  {region: 0x116, script: 0x52, flags: 0x0},
-	888:  {region: 0x164, script: 0x52, flags: 0x0},
-	889:  {region: 0x164, script: 0x52, flags: 0x0},
-	890:  {region: 0x134, script: 0x52, flags: 0x0},
-	891:  {region: 0x164, script: 0x52, flags: 0x0},
-	892:  {region: 0x52, script: 0x52, flags: 0x0},
-	893:  {region: 0x164, script: 0x52, flags: 0x0},
-	894:  {region: 0xcd, script: 0x52, flags: 0x0},
-	895:  {region: 0x12e, script: 0x52, flags: 0x0},
-	896:  {region: 0x130, script: 0x52, flags: 0x0},
-	897:  {region: 0x7f, script: 0x52, flags: 0x0},
-	898:  {region: 0x77, script: 0x52, flags: 0x0},
-	899:  {region: 0x164, script: 0x52, flags: 0x0},
-	901:  {region: 0x164, script: 0x52, flags: 0x0},
-	902:  {region: 0x164, script: 0x52, flags: 0x0},
-	903:  {region: 0x6e, script: 0x52, flags: 0x0},
-	904:  {region: 0x164, script: 0x52, flags: 0x0},
-	905:  {region: 0x164, script: 0x52, flags: 0x0},
-	906:  {region: 0x164, script: 0x52, flags: 0x0},
-	907:  {region: 0x164, script: 0x52, flags: 0x0},
-	908:  {region: 0x98, script: 0x75, flags: 0x0},
-	909:  {region: 0x164, script: 0x52, flags: 0x0},
-	910:  {region: 0x164, script: 0x5, flags: 0x0},
-	911:  {region: 0x7c, script: 0x1e, flags: 0x0},
-	912:  {region: 0x134, script: 0x76, flags: 0x0},
-	913:  {region: 0x164, script: 0x5, flags: 0x0},
-	914:  {region: 0xc4, script: 0x74, flags: 0x0},
-	915:  {region: 0x164, script: 0x52, flags: 0x0},
-	916:  {region: 0x2e, script: 0x3, flags: 0x1},
-	917:  {region: 0xe6, script: 0x52, flags: 0x0},
-	918:  {region: 0x31, script: 0x2, flags: 0x1},
-	919:  {region: 0xe6, script: 0x52, flags: 0x0},
-	920:  {region: 0x2f, script: 0x52, flags: 0x0},
-	921:  {region: 0xef, script: 0x52, flags: 0x0},
-	922:  {region: 0x164, script: 0x52, flags: 0x0},
-	923:  {region: 0x77, script: 0x52, flags: 0x0},
-	924:  {region: 0xd5, script: 0x52, flags: 0x0},
-	925:  {region: 0x134, script: 0x52, flags: 0x0},
-	926:  {region: 0x48, script: 0x52, flags: 0x0},
-	927:  {region: 0x164, script: 0x52, flags: 0x0},
-	928:  {region: 0x9b, script: 0xdd, flags: 0x0},
-	929:  {region: 0x164, script: 0x52, flags: 0x0},
-	930:  {region: 0x5f, script: 0x52, flags: 0x0},
-	931:  {region: 0x164, script: 0x5, flags: 0x0},
-	932:  {region: 0xaf, script: 0x7f, flags: 0x0},
-	934:  {region: 0x164, script: 0x52, flags: 0x0},
-	935:  {region: 0x164, script: 0x52, flags: 0x0},
-	936:  {region: 0x98, script: 0x12, flags: 0x0},
-	937:  {region: 0xa3, script: 0x52, flags: 0x0},
-	938:  {region: 0xe8, script: 0x52, flags: 0x0},
-	939:  {region: 0x164, script: 0x52, flags: 0x0},
-	940:  {region: 0x9d, script: 0x52, flags: 0x0},
-	941:  {region: 0x164, script: 0x52, flags: 0x0},
-	942:  {region: 0x164, script: 0x52, flags: 0x0},
-	943:  {region: 0x86, script: 0x2d, flags: 0x0},
-	944:  {region: 0x74, script: 0x52, flags: 0x0},
-	945:  {region: 0x164, script: 0x52, flags: 0x0},
-	946:  {region: 0xe7, script: 0x45, flags: 0x0},
-	947:  {region: 0x9b, script: 0x5, flags: 0x0},
-	948:  {region: 0x1, script: 0x52, flags: 0x0},
-	949:  {region: 0x23, script: 0x5, flags: 0x0},
-	950:  {region: 0x164, script: 0x52, flags: 0x0},
-	951:  {region: 0x40, script: 0x52, flags: 0x0},
-	952:  {region: 0x164, script: 0x52, flags: 0x0},
-	953:  {region: 0x79, script: 0x52, flags: 0x0},
-	954:  {region: 0x164, script: 0x52, flags: 0x0},
-	955:  {region: 0xe3, script: 0x52, flags: 0x0},
-	956:  {region: 0x88, script: 0x52, flags: 0x0},
-	957:  {region: 0x68, script: 0x52, flags: 0x0},
-	958:  {region: 0x164, script: 0x52, flags: 0x0},
-	959:  {region: 0x98, script: 0x20, flags: 0x0},
-	960:  {region: 0x164, script: 0x52, flags: 0x0},
-	961:  {region: 0x101, script: 0x52, flags: 0x0},
-	962:  {region: 0x94, script: 0x52, flags: 0x0},
-	963:  {region: 0x164, script: 0x52, flags: 0x0},
-	964:  {region: 0x164, script: 0x52, flags: 0x0},
-	965:  {region: 0x9d, script: 0x52, flags: 0x0},
-	966:  {region: 0x164, script: 0x5, flags: 0x0},
-	967:  {region: 0x98, script: 0x52, flags: 0x0},
-	968:  {region: 0x33, script: 0x2, flags: 0x1},
-	969:  {region: 0xda, script: 0x20, flags: 0x0},
-	970:  {region: 0x34, script: 0xe, flags: 0x0},
-	971:  {region: 0x4d, script: 0x52, flags: 0x0},
-	972:  {region: 0x71, script: 0x52, flags: 0x0},
-	973:  {region: 0x4d, script: 0x52, flags: 0x0},
-	974:  {region: 0x9b, script: 0x5, flags: 0x0},
-	975:  {region: 0x10b, script: 0x52, flags: 0x0},
-	976:  {region: 0x39, script: 0x52, flags: 0x0},
-	977:  {region: 0x164, script: 0x52, flags: 0x0},
-	978:  {region: 0xd0, script: 0x52, flags: 0x0},
-	979:  {region: 0x103, script: 0x52, flags: 0x0},
-	980:  {region: 0x94, script: 0x52, flags: 0x0},
-	981:  {region: 0x12e, script: 0x52, flags: 0x0},
-	982:  {region: 0x164, script: 0x52, flags: 0x0},
-	983:  {region: 0x164, script: 0x52, flags: 0x0},
-	984:  {region: 0x72, script: 0x52, flags: 0x0},
-	985:  {region: 0x105, script: 0x1e, flags: 0x0},
-	986:  {region: 0x12f, script: 0x1e, flags: 0x0},
-	987:  {region: 0x108, script: 0x52, flags: 0x0},
-	988:  {region: 0x106, script: 0x52, flags: 0x0},
-	989:  {region: 0x12e, script: 0x52, flags: 0x0},
-	990:  {region: 0x164, script: 0x52, flags: 0x0},
-	991:  {region: 0xa1, script: 0x44, flags: 0x0},
-	992:  {region: 0x98, script: 0x20, flags: 0x0},
-	993:  {region: 0x7f, script: 0x52, flags: 0x0},
-	994:  {region: 0x105, script: 0x1e, flags: 0x0},
-	995:  {region: 0xa3, script: 0x52, flags: 0x0},
-	996:  {region: 0x94, script: 0x52, flags: 0x0},
-	997:  {region: 0x98, script: 0x52, flags: 0x0},
-	998:  {region: 0x98, script: 0xbb, flags: 0x0},
-	999:  {region: 0x164, script: 0x52, flags: 0x0},
-	1000: {region: 0x164, script: 0x52, flags: 0x0},
-	1001: {region: 0x12e, script: 0x52, flags: 0x0},
-	1002: {region: 0x9d, script: 0x52, flags: 0x0},
-	1003: {region: 0x98, script: 0x20, flags: 0x0},
-	1004: {region: 0x164, script: 0x5, flags: 0x0},
-	1005: {region: 0x9d, script: 0x52, flags: 0x0},
-	1006: {region: 0x7a, script: 0x52, flags: 0x0},
-	1007: {region: 0x48, script: 0x52, flags: 0x0},
-	1008: {region: 0x35, script: 0x4, flags: 0x1},
-	1009: {region: 0x9d, script: 0x52, flags: 0x0},
-	1010: {region: 0x9b, script: 0x5, flags: 0x0},
-	1011: {region: 0xd9, script: 0x52, flags: 0x0},
-	1012: {region: 0x4e, script: 0x52, flags: 0x0},
-	1013: {region: 0xd0, script: 0x52, flags: 0x0},
-	1014: {region: 0xce, script: 0x52, flags: 0x0},
-	1015: {region: 0xc2, script: 0x52, flags: 0x0},
-	1016: {region: 0x4b, script: 0x52, flags: 0x0},
-	1017: {region: 0x95, script: 0x72, flags: 0x0},
-	1018: {region: 0xb5, script: 0x52, flags: 0x0},
-	1019: {region: 0x164, script: 0x27, flags: 0x0},
-	1020: {region: 0x164, script: 0x52, flags: 0x0},
-	1022: {region: 0xb9, script: 0xd2, flags: 0x0},
-	1023: {region: 0x164, script: 0x52, flags: 0x0},
-	1024: {region: 0xc3, script: 0x6b, flags: 0x0},
-	1025: {region: 0x164, script: 0x5, flags: 0x0},
-	1026: {region: 0xb2, script: 0xc1, flags: 0x0},
-	1027: {region: 0x6e, script: 0x52, flags: 0x0},
-	1028: {region: 0x164, script: 0x52, flags: 0x0},
-	1029: {region: 0x164, script: 0x52, flags: 0x0},
-	1030: {region: 0x164, script: 0x52, flags: 0x0},
-	1031: {region: 0x164, script: 0x52, flags: 0x0},
-	1032: {region: 0x110, script: 0x52, flags: 0x0},
-	1033: {region: 0x164, script: 0x52, flags: 0x0},
-	1034: {region: 0xe7, script: 0x5, flags: 0x0},
-	1035: {region: 0x164, script: 0x52, flags: 0x0},
-	1036: {region: 0x10e, script: 0x52, flags: 0x0},
-	1037: {region: 0x164, script: 0x52, flags: 0x0},
-	1038: {region: 0xe8, script: 0x52, flags: 0x0},
-	1039: {region: 0x164, script: 0x52, flags: 0x0},
-	1040: {region: 0x94, script: 0x52, flags: 0x0},
-	1041: {region: 0x141, script: 0x52, flags: 0x0},
-	1042: {region: 0x10b, script: 0x52, flags: 0x0},
-	1044: {region: 0x10b, script: 0x52, flags: 0x0},
-	1045: {region: 0x71, script: 0x52, flags: 0x0},
-	1046: {region: 0x96, script: 0xb8, flags: 0x0},
-	1047: {region: 0x164, script: 0x52, flags: 0x0},
-	1048: {region: 0x71, script: 0x52, flags: 0x0},
-	1049: {region: 0x163, script: 0x52, flags: 0x0},
-	1050: {region: 0x164, script: 0x52, flags: 0x0},
-	1051: {region: 0xc2, script: 0x52, flags: 0x0},
-	1052: {region: 0x164, script: 0x52, flags: 0x0},
-	1053: {region: 0x164, script: 0x52, flags: 0x0},
-	1054: {region: 0x164, script: 0x52, flags: 0x0},
-	1055: {region: 0x114, script: 0x52, flags: 0x0},
-	1056: {region: 0x164, script: 0x52, flags: 0x0},
-	1057: {region: 0x164, script: 0x52, flags: 0x0},
-	1058: {region: 0x122, script: 0xd5, flags: 0x0},
-	1059: {region: 0x164, script: 0x52, flags: 0x0},
-	1060: {region: 0x164, script: 0x52, flags: 0x0},
-	1061: {region: 0x164, script: 0x52, flags: 0x0},
-	1062: {region: 0x164, script: 0x52, flags: 0x0},
-	1063: {region: 0x26, script: 0x52, flags: 0x0},
-	1064: {region: 0x39, script: 0x5, flags: 0x1},
-	1065: {region: 0x98, script: 0xc2, flags: 0x0},
-	1066: {region: 0x115, script: 0x52, flags: 0x0},
-	1067: {region: 0x113, script: 0x52, flags: 0x0},
-	1068: {region: 0x98, script: 0x20, flags: 0x0},
-	1069: {region: 0x160, script: 0x52, flags: 0x0},
-	1070: {region: 0x164, script: 0x52, flags: 0x0},
-	1071: {region: 0x164, script: 0x52, flags: 0x0},
-	1072: {region: 0x6c, script: 0x52, flags: 0x0},
-	1073: {region: 0x160, script: 0x52, flags: 0x0},
-	1074: {region: 0x164, script: 0x52, flags: 0x0},
-	1075: {region: 0x5f, script: 0x52, flags: 0x0},
-	1076: {region: 0x94, script: 0x52, flags: 0x0},
-	1077: {region: 0x164, script: 0x52, flags: 0x0},
-	1078: {region: 0x164, script: 0x52, flags: 0x0},
-	1079: {region: 0x12e, script: 0x52, flags: 0x0},
-	1080: {region: 0x164, script: 0x52, flags: 0x0},
-	1081: {region: 0x83, script: 0x52, flags: 0x0},
-	1082: {region: 0x10b, script: 0x52, flags: 0x0},
-	1083: {region: 0x12e, script: 0x52, flags: 0x0},
-	1084: {region: 0x15e, script: 0x5, flags: 0x0},
-	1085: {region: 0x4a, script: 0x52, flags: 0x0},
-	1086: {region: 0x5f, script: 0x52, flags: 0x0},
-	1087: {region: 0x164, script: 0x52, flags: 0x0},
-	1088: {region: 0x98, script: 0x20, flags: 0x0},
-	1089: {region: 0x94, script: 0x52, flags: 0x0},
-	1090: {region: 0x164, script: 0x52, flags: 0x0},
-	1091: {region: 0x34, script: 0xe, flags: 0x0},
-	1092: {region: 0x9a, script: 0xc5, flags: 0x0},
-	1093: {region: 0xe8, script: 0x52, flags: 0x0},
-	1094: {region: 0x98, script: 0xcd, flags: 0x0},
-	1095: {region: 0xda, script: 0x20, flags: 0x0},
-	1096: {region: 0x164, script: 0x52, flags: 0x0},
-	1097: {region: 0x164, script: 0x52, flags: 0x0},
-	1098: {region: 0x164, script: 0x52, flags: 0x0},
-	1099: {region: 0x164, script: 0x52, flags: 0x0},
-	1100: {region: 0x164, script: 0x52, flags: 0x0},
-	1101: {region: 0x164, script: 0x52, flags: 0x0},
-	1102: {region: 0x164, script: 0x52, flags: 0x0},
-	1103: {region: 0x164, script: 0x52, flags: 0x0},
-	1104: {region: 0xe6, script: 0x52, flags: 0x0},
-	1105: {region: 0x164, script: 0x52, flags: 0x0},
-	1106: {region: 0x164, script: 0x52, flags: 0x0},
-	1107: {region: 0x98, script: 0x4a, flags: 0x0},
-	1108: {region: 0x52, script: 0xcb, flags: 0x0},
-	1109: {region: 0xda, script: 0x20, flags: 0x0},
-	1110: {region: 0xda, script: 0x20, flags: 0x0},
-	1111: {region: 0x98, script: 0xd0, flags: 0x0},
-	1112: {region: 0x164, script: 0x52, flags: 0x0},
-	1113: {region: 0x111, script: 0x52, flags: 0x0},
-	1114: {region: 0x130, script: 0x52, flags: 0x0},
-	1115: {region: 0x125, script: 0x52, flags: 0x0},
-	1116: {region: 0x164, script: 0x52, flags: 0x0},
-	1117: {region: 0x3e, script: 0x3, flags: 0x1},
-	1118: {region: 0x164, script: 0x52, flags: 0x0},
-	1119: {region: 0x164, script: 0x52, flags: 0x0},
-	1120: {region: 0x164, script: 0x52, flags: 0x0},
-	1121: {region: 0x122, script: 0xd5, flags: 0x0},
-	1122: {region: 0xda, script: 0x20, flags: 0x0},
-	1123: {region: 0xda, script: 0x20, flags: 0x0},
-	1124: {region: 0xda, script: 0x20, flags: 0x0},
-	1125: {region: 0x6e, script: 0x27, flags: 0x0},
-	1126: {region: 0x164, script: 0x52, flags: 0x0},
-	1127: {region: 0x6c, script: 0x27, flags: 0x0},
-	1128: {region: 0x164, script: 0x52, flags: 0x0},
-	1129: {region: 0x164, script: 0x52, flags: 0x0},
-	1130: {region: 0x164, script: 0x52, flags: 0x0},
-	1131: {region: 0xd5, script: 0x52, flags: 0x0},
-	1132: {region: 0x126, script: 0x52, flags: 0x0},
-	1133: {region: 0x124, script: 0x52, flags: 0x0},
-	1134: {region: 0x31, script: 0x52, flags: 0x0},
-	1135: {region: 0xda, script: 0x20, flags: 0x0},
-	1136: {region: 0xe6, script: 0x52, flags: 0x0},
-	1137: {region: 0x164, script: 0x52, flags: 0x0},
-	1138: {region: 0x164, script: 0x52, flags: 0x0},
-	1139: {region: 0x31, script: 0x52, flags: 0x0},
-	1140: {region: 0xd3, script: 0x52, flags: 0x0},
-	1141: {region: 0x164, script: 0x52, flags: 0x0},
-	1142: {region: 0x160, script: 0x52, flags: 0x0},
-	1143: {region: 0x164, script: 0x52, flags: 0x0},
-	1144: {region: 0x128, script: 0x52, flags: 0x0},
-	1145: {region: 0x164, script: 0x52, flags: 0x0},
-	1146: {region: 0xcd, script: 0x52, flags: 0x0},
-	1147: {region: 0x164, script: 0x52, flags: 0x0},
-	1148: {region: 0xe5, script: 0x52, flags: 0x0},
-	1149: {region: 0x164, script: 0x52, flags: 0x0},
-	1150: {region: 0x164, script: 0x52, flags: 0x0},
-	1151: {region: 0x164, script: 0x52, flags: 0x0},
-	1152: {region: 0x12a, script: 0x52, flags: 0x0},
-	1153: {region: 0x12a, script: 0x52, flags: 0x0},
-	1154: {region: 0x12d, script: 0x52, flags: 0x0},
-	1155: {region: 0x164, script: 0x5, flags: 0x0},
-	1156: {region: 0x160, script: 0x52, flags: 0x0},
-	1157: {region: 0x86, script: 0x2d, flags: 0x0},
-	1158: {region: 0xda, script: 0x20, flags: 0x0},
-	1159: {region: 0xe6, script: 0x52, flags: 0x0},
-	1160: {region: 0x42, script: 0xd6, flags: 0x0},
-	1161: {region: 0x164, script: 0x52, flags: 0x0},
-	1162: {region: 0x105, script: 0x1e, flags: 0x0},
-	1163: {region: 0x164, script: 0x52, flags: 0x0},
-	1164: {region: 0x164, script: 0x52, flags: 0x0},
-	1165: {region: 0x130, script: 0x52, flags: 0x0},
-	1166: {region: 0x164, script: 0x52, flags: 0x0},
-	1167: {region: 0x122, script: 0xd5, flags: 0x0},
-	1168: {region: 0x31, script: 0x52, flags: 0x0},
-	1169: {region: 0x164, script: 0x52, flags: 0x0},
-	1170: {region: 0x164, script: 0x52, flags: 0x0},
-	1171: {region: 0xcd, script: 0x52, flags: 0x0},
-	1172: {region: 0x164, script: 0x52, flags: 0x0},
-	1173: {region: 0x164, script: 0x52, flags: 0x0},
-	1174: {region: 0x12c, script: 0x52, flags: 0x0},
-	1175: {region: 0x164, script: 0x52, flags: 0x0},
-	1177: {region: 0x164, script: 0x52, flags: 0x0},
-	1178: {region: 0xd3, script: 0x52, flags: 0x0},
-	1179: {region: 0x52, script: 0xce, flags: 0x0},
-	1180: {region: 0xe4, script: 0x52, flags: 0x0},
-	1181: {region: 0x164, script: 0x52, flags: 0x0},
-	1182: {region: 0x105, script: 0x1e, flags: 0x0},
-	1183: {region: 0xb9, script: 0x52, flags: 0x0},
-	1184: {region: 0x164, script: 0x52, flags: 0x0},
-	1185: {region: 0x105, script: 0x1e, flags: 0x0},
-	1186: {region: 0x41, script: 0x4, flags: 0x1},
-	1187: {region: 0x11b, script: 0xd8, flags: 0x0},
-	1188: {region: 0x12f, script: 0x1e, flags: 0x0},
-	1189: {region: 0x74, script: 0x52, flags: 0x0},
-	1190: {region: 0x29, script: 0x52, flags: 0x0},
-	1192: {region: 0x45, script: 0x3, flags: 0x1},
-	1193: {region: 0x98, script: 0xe, flags: 0x0},
-	1194: {region: 0xe7, script: 0x5, flags: 0x0},
-	1195: {region: 0x164, script: 0x52, flags: 0x0},
-	1196: {region: 0x164, script: 0x52, flags: 0x0},
-	1197: {region: 0x164, script: 0x52, flags: 0x0},
-	1198: {region: 0x164, script: 0x52, flags: 0x0},
-	1199: {region: 0x164, script: 0x52, flags: 0x0},
-	1200: {region: 0x164, script: 0x52, flags: 0x0},
-	1201: {region: 0x164, script: 0x52, flags: 0x0},
-	1202: {region: 0x48, script: 0x4, flags: 0x1},
-	1203: {region: 0x164, script: 0x52, flags: 0x0},
-	1204: {region: 0xb3, script: 0xd9, flags: 0x0},
-	1205: {region: 0x164, script: 0x52, flags: 0x0},
-	1206: {region: 0x160, script: 0x52, flags: 0x0},
-	1207: {region: 0x9d, script: 0x52, flags: 0x0},
-	1208: {region: 0x105, script: 0x52, flags: 0x0},
-	1209: {region: 0x13d, script: 0x52, flags: 0x0},
-	1210: {region: 0x11a, script: 0x52, flags: 0x0},
-	1211: {region: 0x164, script: 0x52, flags: 0x0},
-	1212: {region: 0x35, script: 0x52, flags: 0x0},
-	1213: {region: 0x5f, script: 0x52, flags: 0x0},
-	1214: {region: 0xd0, script: 0x52, flags: 0x0},
-	1215: {region: 0x1, script: 0x52, flags: 0x0},
-	1216: {region: 0x105, script: 0x52, flags: 0x0},
-	1217: {region: 0x69, script: 0x52, flags: 0x0},
-	1218: {region: 0x12e, script: 0x52, flags: 0x0},
-	1219: {region: 0x164, script: 0x52, flags: 0x0},
-	1220: {region: 0x35, script: 0x52, flags: 0x0},
-	1221: {region: 0x4d, script: 0x52, flags: 0x0},
-	1222: {region: 0x164, script: 0x52, flags: 0x0},
-	1223: {region: 0x6e, script: 0x27, flags: 0x0},
-	1224: {region: 0x164, script: 0x52, flags: 0x0},
-	1225: {region: 0xe6, script: 0x52, flags: 0x0},
-	1226: {region: 0x2e, script: 0x52, flags: 0x0},
-	1227: {region: 0x98, script: 0xd0, flags: 0x0},
-	1228: {region: 0x98, script: 0x20, flags: 0x0},
-	1229: {region: 0x164, script: 0x52, flags: 0x0},
-	1230: {region: 0x164, script: 0x52, flags: 0x0},
-	1231: {region: 0x164, script: 0x52, flags: 0x0},
-	1232: {region: 0x164, script: 0x52, flags: 0x0},
-	1233: {region: 0x164, script: 0x52, flags: 0x0},
-	1234: {region: 0x164, script: 0x52, flags: 0x0},
-	1235: {region: 0x164, script: 0x52, flags: 0x0},
-	1236: {region: 0x164, script: 0x52, flags: 0x0},
-	1237: {region: 0x164, script: 0x52, flags: 0x0},
-	1238: {region: 0x13f, script: 0x52, flags: 0x0},
-	1239: {region: 0x164, script: 0x52, flags: 0x0},
-	1240: {region: 0x164, script: 0x52, flags: 0x0},
-	1241: {region: 0xa7, script: 0x5, flags: 0x0},
-	1242: {region: 0x164, script: 0x52, flags: 0x0},
-	1243: {region: 0x113, script: 0x52, flags: 0x0},
-	1244: {region: 0x164, script: 0x52, flags: 0x0},
-	1245: {region: 0x164, script: 0x52, flags: 0x0},
-	1246: {region: 0x164, script: 0x52, flags: 0x0},
-	1247: {region: 0x164, script: 0x52, flags: 0x0},
-	1248: {region: 0x98, script: 0x20, flags: 0x0},
-	1249: {region: 0x52, script: 0x34, flags: 0x0},
-	1250: {region: 0x164, script: 0x52, flags: 0x0},
-	1251: {region: 0x164, script: 0x52, flags: 0x0},
-	1252: {region: 0x40, script: 0x52, flags: 0x0},
-	1253: {region: 0x164, script: 0x52, flags: 0x0},
-	1254: {region: 0x12a, script: 0x18, flags: 0x0},
-	1255: {region: 0x164, script: 0x52, flags: 0x0},
-	1256: {region: 0x160, script: 0x52, flags: 0x0},
-	1257: {region: 0x164, script: 0x52, flags: 0x0},
-	1258: {region: 0x12a, script: 0x5a, flags: 0x0},
-	1259: {region: 0x12a, script: 0x5b, flags: 0x0},
-	1260: {region: 0x7c, script: 0x29, flags: 0x0},
-	1261: {region: 0x52, script: 0x5e, flags: 0x0},
-	1262: {region: 0x10a, script: 0x62, flags: 0x0},
-	1263: {region: 0x107, script: 0x6c, flags: 0x0},
-	1264: {region: 0x98, script: 0x20, flags: 0x0},
-	1265: {region: 0x130, script: 0x52, flags: 0x0},
-	1266: {region: 0x164, script: 0x52, flags: 0x0},
-	1267: {region: 0x9b, script: 0x82, flags: 0x0},
-	1268: {region: 0x164, script: 0x52, flags: 0x0},
-	1269: {region: 0x15d, script: 0xba, flags: 0x0},
-	1270: {region: 0x164, script: 0x52, flags: 0x0},
-	1271: {region: 0x164, script: 0x52, flags: 0x0},
-	1272: {region: 0xda, script: 0x20, flags: 0x0},
-	1273: {region: 0x164, script: 0x52, flags: 0x0},
-	1274: {region: 0x164, script: 0x52, flags: 0x0},
-	1275: {region: 0xd0, script: 0x52, flags: 0x0},
-	1276: {region: 0x74, script: 0x52, flags: 0x0},
-	1277: {region: 0x164, script: 0x52, flags: 0x0},
-	1278: {region: 0x164, script: 0x52, flags: 0x0},
-	1279: {region: 0x51, script: 0x52, flags: 0x0},
-	1280: {region: 0x164, script: 0x52, flags: 0x0},
-	1281: {region: 0x164, script: 0x52, flags: 0x0},
-	1282: {region: 0x164, script: 0x52, flags: 0x0},
-	1283: {region: 0x51, script: 0x52, flags: 0x0},
-	1284: {region: 0x164, script: 0x52, flags: 0x0},
-	1285: {region: 0x164, script: 0x52, flags: 0x0},
-	1286: {region: 0x164, script: 0x52, flags: 0x0},
-	1287: {region: 0x164, script: 0x52, flags: 0x0},
-	1288: {region: 0x1, script: 0x37, flags: 0x0},
-	1289: {region: 0x164, script: 0x52, flags: 0x0},
-	1290: {region: 0x164, script: 0x52, flags: 0x0},
-	1291: {region: 0x164, script: 0x52, flags: 0x0},
-	1292: {region: 0x164, script: 0x52, flags: 0x0},
-	1293: {region: 0x164, script: 0x52, flags: 0x0},
-	1294: {region: 0xd5, script: 0x52, flags: 0x0},
-	1295: {region: 0x164, script: 0x52, flags: 0x0},
-	1296: {region: 0x164, script: 0x52, flags: 0x0},
-	1297: {region: 0x164, script: 0x52, flags: 0x0},
-	1298: {region: 0x40, script: 0x52, flags: 0x0},
-	1299: {region: 0x164, script: 0x52, flags: 0x0},
-	1300: {region: 0xce, script: 0x52, flags: 0x0},
-	1301: {region: 0x4c, script: 0x3, flags: 0x1},
-	1302: {region: 0x164, script: 0x52, flags: 0x0},
-	1303: {region: 0x164, script: 0x52, flags: 0x0},
-	1304: {region: 0x164, script: 0x52, flags: 0x0},
-	1305: {region: 0x52, script: 0x52, flags: 0x0},
-	1306: {region: 0x10a, script: 0x52, flags: 0x0},
-	1308: {region: 0xa7, script: 0x5, flags: 0x0},
-	1309: {region: 0xd8, script: 0x52, flags: 0x0},
-	1310: {region: 0xb9, script: 0xd2, flags: 0x0},
-	1311: {region: 0x4f, script: 0x14, flags: 0x1},
-	1312: {region: 0x164, script: 0x52, flags: 0x0},
-	1313: {region: 0x121, script: 0x52, flags: 0x0},
-	1314: {region: 0xcf, script: 0x52, flags: 0x0},
-	1315: {region: 0x164, script: 0x52, flags: 0x0},
-	1316: {region: 0x160, script: 0x52, flags: 0x0},
-	1318: {region: 0x12a, script: 0x52, flags: 0x0},
-}
-
-// likelyLangList holds lists info associated with likelyLang.
-// Size: 396 bytes, 99 elements
-var likelyLangList = [99]likelyScriptRegion{
-	0:  {region: 0x9b, script: 0x7, flags: 0x0},
-	1:  {region: 0xa0, script: 0x6d, flags: 0x2},
-	2:  {region: 0x11b, script: 0x78, flags: 0x2},
-	3:  {region: 0x31, script: 0x52, flags: 0x0},
-	4:  {region: 0x9a, script: 0x5, flags: 0x4},
-	5:  {region: 0x9b, script: 0x5, flags: 0x4},
-	6:  {region: 0x105, script: 0x1e, flags: 0x4},
-	7:  {region: 0x9b, script: 0x5, flags: 0x2},
-	8:  {region: 0x98, script: 0xe, flags: 0x0},
-	9:  {region: 0x34, script: 0x16, flags: 0x2},
-	10: {region: 0x105, script: 0x1e, flags: 0x0},
-	11: {region: 0x37, script: 0x2a, flags: 0x2},
-	12: {region: 0x134, script: 0x52, flags: 0x0},
-	13: {region: 0x7a, script: 0xbd, flags: 0x2},
-	14: {region: 0x113, script: 0x52, flags: 0x0},
-	15: {region: 0x83, script: 0x1, flags: 0x2},
-	16: {region: 0x5c, script: 0x1d, flags: 0x0},
-	17: {region: 0x86, script: 0x57, flags: 0x2},
-	18: {region: 0xd5, script: 0x52, flags: 0x0},
-	19: {region: 0x51, script: 0x5, flags: 0x4},
-	20: {region: 0x10a, script: 0x5, flags: 0x4},
-	21: {region: 0xad, script: 0x1e, flags: 0x0},
-	22: {region: 0x23, script: 0x5, flags: 0x4},
-	23: {region: 0x52, script: 0x5, flags: 0x4},
-	24: {region: 0x9b, script: 0x5, flags: 0x4},
-	25: {region: 0xc4, script: 0x5, flags: 0x4},
-	26: {region: 0x52, script: 0x5, flags: 0x2},
-	27: {region: 0x12a, script: 0x52, flags: 0x0},
-	28: {region: 0xaf, script: 0x5, flags: 0x4},
-	29: {region: 0x9a, script: 0x5, flags: 0x2},
-	30: {region: 0xa4, script: 0x1e, flags: 0x0},
-	31: {region: 0x52, script: 0x5, flags: 0x4},
-	32: {region: 0x12a, script: 0x52, flags: 0x4},
-	33: {region: 0x52, script: 0x5, flags: 0x2},
-	34: {region: 0x12a, script: 0x52, flags: 0x2},
-	35: {region: 0xda, script: 0x20, flags: 0x0},
-	36: {region: 0x98, script: 0x55, flags: 0x2},
-	37: {region: 0x82, script: 0x52, flags: 0x0},
-	38: {region: 0x83, script: 0x70, flags: 0x4},
-	39: {region: 0x83, script: 0x70, flags: 0x2},
-	40: {region: 0xc4, script: 0x1e, flags: 0x0},
-	41: {region: 0x52, script: 0x66, flags: 0x4},
-	42: {region: 0x52, script: 0x66, flags: 0x2},
-	43: {region: 0xcf, script: 0x52, flags: 0x0},
-	44: {region: 0x49, script: 0x5, flags: 0x4},
-	45: {region: 0x94, script: 0x5, flags: 0x4},
-	46: {region: 0x98, script: 0x2f, flags: 0x0},
-	47: {region: 0xe7, script: 0x5, flags: 0x4},
-	48: {region: 0xe7, script: 0x5, flags: 0x2},
-	49: {region: 0x9b, script: 0x7c, flags: 0x0},
-	50: {region: 0x52, script: 0x7d, flags: 0x2},
-	51: {region: 0xb9, script: 0xd2, flags: 0x0},
-	52: {region: 0xd8, script: 0x52, flags: 0x4},
-	53: {region: 0xe7, script: 0x5, flags: 0x0},
-	54: {region: 0x98, script: 0x20, flags: 0x2},
-	55: {region: 0x98, script: 0x47, flags: 0x2},
-	56: {region: 0x98, script: 0xc0, flags: 0x2},
-	57: {region: 0x104, script: 0x1e, flags: 0x0},
-	58: {region: 0xbc, script: 0x52, flags: 0x4},
-	59: {region: 0x103, script: 0x52, flags: 0x4},
-	60: {region: 0x105, script: 0x52, flags: 0x4},
-	61: {region: 0x12a, script: 0x52, flags: 0x4},
-	62: {region: 0x123, script: 0x1e, flags: 0x0},
-	63: {region: 0xe7, script: 0x5, flags: 0x4},
-	64: {region: 0xe7, script: 0x5, flags: 0x2},
-	65: {region: 0x52, script: 0x5, flags: 0x0},
-	66: {region: 0xad, script: 0x1e, flags: 0x4},
-	67: {region: 0xc4, script: 0x1e, flags: 0x4},
-	68: {region: 0xad, script: 0x1e, flags: 0x2},
-	69: {region: 0x98, script: 0xe, flags: 0x0},
-	70: {region: 0xda, script: 0x20, flags: 0x4},
-	71: {region: 0xda, script: 0x20, flags: 0x2},
-	72: {region: 0x136, script: 0x52, flags: 0x0},
-	73: {region: 0x23, script: 0x5, flags: 0x4},
-	74: {region: 0x52, script: 0x1e, flags: 0x4},
-	75: {region: 0x23, script: 0x5, flags: 0x2},
-	76: {region: 0x8c, script: 0x35, flags: 0x0},
-	77: {region: 0x52, script: 0x34, flags: 0x4},
-	78: {region: 0x52, script: 0x34, flags: 0x2},
-	79: {region: 0x52, script: 0x34, flags: 0x0},
-	80: {region: 0x2e, script: 0x35, flags: 0x4},
-	81: {region: 0x3d, script: 0x35, flags: 0x4},
-	82: {region: 0x7a, script: 0x35, flags: 0x4},
-	83: {region: 0x7d, script: 0x35, flags: 0x4},
-	84: {region: 0x8c, script: 0x35, flags: 0x4},
-	85: {region: 0x94, script: 0x35, flags: 0x4},
-	86: {region: 0xc5, script: 0x35, flags: 0x4},
-	87: {region: 0xcf, script: 0x35, flags: 0x4},
-	88: {region: 0xe1, script: 0x35, flags: 0x4},
-	89: {region: 0xe4, script: 0x35, flags: 0x4},
-	90: {region: 0xe6, script: 0x35, flags: 0x4},
-	91: {region: 0x115, script: 0x35, flags: 0x4},
-	92: {region: 0x122, script: 0x35, flags: 0x4},
-	93: {region: 0x12d, script: 0x35, flags: 0x4},
-	94: {region: 0x134, script: 0x35, flags: 0x4},
-	95: {region: 0x13d, script: 0x35, flags: 0x4},
-	96: {region: 0x12d, script: 0x11, flags: 0x2},
-	97: {region: 0x12d, script: 0x30, flags: 0x2},
-	98: {region: 0x12d, script: 0x35, flags: 0x2},
-}
-
-type likelyLangScript struct {
-	lang   uint16
-	script uint8
-	flags  uint8
-}
-
-// likelyRegion is a lookup table, indexed by regionID, for the most likely
-// languages and scripts given incomplete information. If more entries exist
-// for a given regionID, lang and script are the index and size respectively
-// of the list in likelyRegionList.
-// TODO: exclude containers and user-definable regions from the list.
-// Size: 1428 bytes, 357 elements
-var likelyRegion = [357]likelyLangScript{
-	33:  {lang: 0xd5, script: 0x52, flags: 0x0},
-	34:  {lang: 0x39, script: 0x5, flags: 0x0},
-	35:  {lang: 0x0, script: 0x2, flags: 0x1},
-	38:  {lang: 0x2, script: 0x2, flags: 0x1},
-	39:  {lang: 0x4, script: 0x2, flags: 0x1},
-	41:  {lang: 0x3b7, script: 0x52, flags: 0x0},
-	42:  {lang: 0x0, script: 0x52, flags: 0x0},
-	43:  {lang: 0x139, script: 0x52, flags: 0x0},
-	44:  {lang: 0x411, script: 0x52, flags: 0x0},
-	45:  {lang: 0x109, script: 0x52, flags: 0x0},
-	47:  {lang: 0x35e, script: 0x52, flags: 0x0},
-	48:  {lang: 0x43a, script: 0x52, flags: 0x0},
-	49:  {lang: 0x57, script: 0x52, flags: 0x0},
-	50:  {lang: 0x6, script: 0x2, flags: 0x1},
-	52:  {lang: 0xa3, script: 0xe, flags: 0x0},
-	53:  {lang: 0x35e, script: 0x52, flags: 0x0},
-	54:  {lang: 0x159, script: 0x52, flags: 0x0},
-	55:  {lang: 0x7d, script: 0x1e, flags: 0x0},
-	56:  {lang: 0x39, script: 0x5, flags: 0x0},
-	57:  {lang: 0x3d0, script: 0x52, flags: 0x0},
-	58:  {lang: 0x159, script: 0x52, flags: 0x0},
-	59:  {lang: 0x159, script: 0x52, flags: 0x0},
-	61:  {lang: 0x316, script: 0x52, flags: 0x0},
-	62:  {lang: 0x139, script: 0x52, flags: 0x0},
-	63:  {lang: 0x398, script: 0x52, flags: 0x0},
-	64:  {lang: 0x3b7, script: 0x52, flags: 0x0},
-	66:  {lang: 0x8, script: 0x2, flags: 0x1},
-	68:  {lang: 0x0, script: 0x52, flags: 0x0},
-	70:  {lang: 0x70, script: 0x1e, flags: 0x0},
-	72:  {lang: 0x508, script: 0x37, flags: 0x2},
-	73:  {lang: 0x316, script: 0x5, flags: 0x2},
-	74:  {lang: 0x43b, script: 0x52, flags: 0x0},
-	75:  {lang: 0x159, script: 0x52, flags: 0x0},
-	76:  {lang: 0x159, script: 0x52, flags: 0x0},
-	77:  {lang: 0x109, script: 0x52, flags: 0x0},
-	78:  {lang: 0x159, script: 0x52, flags: 0x0},
-	80:  {lang: 0x139, script: 0x52, flags: 0x0},
-	81:  {lang: 0x159, script: 0x52, flags: 0x0},
-	82:  {lang: 0xa, script: 0x5, flags: 0x1},
-	83:  {lang: 0x139, script: 0x52, flags: 0x0},
-	84:  {lang: 0x0, script: 0x52, flags: 0x0},
-	85:  {lang: 0x139, script: 0x52, flags: 0x0},
-	88:  {lang: 0x139, script: 0x52, flags: 0x0},
-	89:  {lang: 0x3b7, script: 0x52, flags: 0x0},
-	90:  {lang: 0x398, script: 0x52, flags: 0x0},
-	92:  {lang: 0xf, script: 0x2, flags: 0x1},
-	93:  {lang: 0xf6, script: 0x52, flags: 0x0},
-	95:  {lang: 0x109, script: 0x52, flags: 0x0},
-	97:  {lang: 0x1, script: 0x52, flags: 0x0},
-	98:  {lang: 0xfd, script: 0x52, flags: 0x0},
-	100: {lang: 0x139, script: 0x52, flags: 0x0},
-	102: {lang: 0x11, script: 0x2, flags: 0x1},
-	103: {lang: 0x139, script: 0x52, flags: 0x0},
-	104: {lang: 0x139, script: 0x52, flags: 0x0},
-	105: {lang: 0x13b, script: 0x52, flags: 0x0},
-	106: {lang: 0x39, script: 0x5, flags: 0x0},
-	107: {lang: 0x39, script: 0x5, flags: 0x0},
-	108: {lang: 0x465, script: 0x27, flags: 0x0},
-	109: {lang: 0x139, script: 0x52, flags: 0x0},
-	110: {lang: 0x13, script: 0x2, flags: 0x1},
-	112: {lang: 0x109, script: 0x52, flags: 0x0},
-	113: {lang: 0x14c, script: 0x52, flags: 0x0},
-	114: {lang: 0x1b9, script: 0x20, flags: 0x2},
-	117: {lang: 0x153, script: 0x52, flags: 0x0},
-	119: {lang: 0x159, script: 0x52, flags: 0x0},
-	121: {lang: 0x159, script: 0x52, flags: 0x0},
-	122: {lang: 0x15, script: 0x2, flags: 0x1},
-	124: {lang: 0x17, script: 0x3, flags: 0x1},
-	125: {lang: 0x159, script: 0x52, flags: 0x0},
-	127: {lang: 0x20, script: 0x52, flags: 0x0},
-	129: {lang: 0x23d, script: 0x52, flags: 0x0},
-	131: {lang: 0x159, script: 0x52, flags: 0x0},
-	132: {lang: 0x159, script: 0x52, flags: 0x0},
-	133: {lang: 0x139, script: 0x52, flags: 0x0},
-	134: {lang: 0x1a, script: 0x2, flags: 0x1},
-	135: {lang: 0x0, script: 0x52, flags: 0x0},
-	136: {lang: 0x139, script: 0x52, flags: 0x0},
-	138: {lang: 0x3b7, script: 0x52, flags: 0x0},
-	140: {lang: 0x51f, script: 0x35, flags: 0x0},
-	141: {lang: 0x0, script: 0x52, flags: 0x0},
-	142: {lang: 0x139, script: 0x52, flags: 0x0},
-	143: {lang: 0x1ca, script: 0x52, flags: 0x0},
-	144: {lang: 0x1cd, script: 0x52, flags: 0x0},
-	145: {lang: 0x1ce, script: 0x52, flags: 0x0},
-	147: {lang: 0x139, script: 0x52, flags: 0x0},
-	148: {lang: 0x1c, script: 0x2, flags: 0x1},
-	150: {lang: 0x1b5, script: 0x37, flags: 0x0},
-	152: {lang: 0x1e, script: 0x3, flags: 0x1},
-	154: {lang: 0x39, script: 0x5, flags: 0x0},
-	155: {lang: 0x21, script: 0x2, flags: 0x1},
-	156: {lang: 0x1f0, script: 0x52, flags: 0x0},
-	157: {lang: 0x1f1, script: 0x52, flags: 0x0},
-	160: {lang: 0x39, script: 0x5, flags: 0x0},
-	161: {lang: 0x1f8, script: 0x41, flags: 0x0},
-	163: {lang: 0x43b, script: 0x52, flags: 0x0},
-	164: {lang: 0x281, script: 0x1e, flags: 0x0},
-	165: {lang: 0x23, script: 0x3, flags: 0x1},
-	167: {lang: 0x26, script: 0x2, flags: 0x1},
-	169: {lang: 0x24b, script: 0x4b, flags: 0x0},
-	170: {lang: 0x24b, script: 0x4b, flags: 0x0},
-	171: {lang: 0x39, script: 0x5, flags: 0x0},
-	173: {lang: 0x3d9, script: 0x1e, flags: 0x0},
-	174: {lang: 0x28, script: 0x2, flags: 0x1},
-	175: {lang: 0x39, script: 0x5, flags: 0x0},
-	177: {lang: 0x109, script: 0x52, flags: 0x0},
-	178: {lang: 0x402, script: 0xc1, flags: 0x0},
-	180: {lang: 0x431, script: 0x52, flags: 0x0},
-	181: {lang: 0x2b7, script: 0x52, flags: 0x0},
-	182: {lang: 0x159, script: 0x52, flags: 0x0},
-	183: {lang: 0x2be, script: 0x52, flags: 0x0},
-	184: {lang: 0x39, script: 0x5, flags: 0x0},
-	185: {lang: 0x2a, script: 0x2, flags: 0x1},
-	186: {lang: 0x159, script: 0x52, flags: 0x0},
-	187: {lang: 0x2c, script: 0x2, flags: 0x1},
-	188: {lang: 0x428, script: 0x52, flags: 0x0},
-	189: {lang: 0x159, script: 0x52, flags: 0x0},
-	190: {lang: 0x2e8, script: 0x52, flags: 0x0},
-	193: {lang: 0x2e, script: 0x2, flags: 0x1},
-	194: {lang: 0x9e, script: 0x52, flags: 0x0},
-	195: {lang: 0x30, script: 0x2, flags: 0x1},
-	196: {lang: 0x32, script: 0x2, flags: 0x1},
-	197: {lang: 0x34, script: 0x2, flags: 0x1},
-	199: {lang: 0x159, script: 0x52, flags: 0x0},
-	200: {lang: 0x36, script: 0x2, flags: 0x1},
-	202: {lang: 0x317, script: 0x52, flags: 0x0},
-	203: {lang: 0x38, script: 0x3, flags: 0x1},
-	204: {lang: 0x124, script: 0xd4, flags: 0x0},
-	206: {lang: 0x139, script: 0x52, flags: 0x0},
-	207: {lang: 0x316, script: 0x52, flags: 0x0},
-	208: {lang: 0x3b7, script: 0x52, flags: 0x0},
-	209: {lang: 0x15, script: 0x52, flags: 0x0},
-	210: {lang: 0x159, script: 0x52, flags: 0x0},
-	211: {lang: 0x1ad, script: 0x52, flags: 0x0},
-	213: {lang: 0x1ad, script: 0x5, flags: 0x2},
-	215: {lang: 0x139, script: 0x52, flags: 0x0},
-	216: {lang: 0x35e, script: 0x52, flags: 0x0},
-	217: {lang: 0x33e, script: 0x52, flags: 0x0},
-	218: {lang: 0x348, script: 0x20, flags: 0x0},
-	224: {lang: 0x39, script: 0x5, flags: 0x0},
-	225: {lang: 0x139, script: 0x52, flags: 0x0},
-	227: {lang: 0x139, script: 0x52, flags: 0x0},
-	228: {lang: 0x159, script: 0x52, flags: 0x0},
-	229: {lang: 0x47c, script: 0x52, flags: 0x0},
-	230: {lang: 0x14e, script: 0x52, flags: 0x0},
-	231: {lang: 0x3b, script: 0x3, flags: 0x1},
-	232: {lang: 0x3e, script: 0x2, flags: 0x1},
-	233: {lang: 0x159, script: 0x52, flags: 0x0},
-	235: {lang: 0x139, script: 0x52, flags: 0x0},
-	236: {lang: 0x39, script: 0x5, flags: 0x0},
-	237: {lang: 0x3b7, script: 0x52, flags: 0x0},
-	239: {lang: 0x399, script: 0x52, flags: 0x0},
-	240: {lang: 0x18e, script: 0x52, flags: 0x0},
-	242: {lang: 0x39, script: 0x5, flags: 0x0},
-	257: {lang: 0x159, script: 0x52, flags: 0x0},
-	259: {lang: 0x40, script: 0x2, flags: 0x1},
-	260: {lang: 0x428, script: 0x1e, flags: 0x0},
-	261: {lang: 0x42, script: 0x2, flags: 0x1},
-	262: {lang: 0x3dc, script: 0x52, flags: 0x0},
-	263: {lang: 0x39, script: 0x5, flags: 0x0},
-	265: {lang: 0x159, script: 0x52, flags: 0x0},
-	266: {lang: 0x39, script: 0x5, flags: 0x0},
-	267: {lang: 0x44, script: 0x2, flags: 0x1},
-	270: {lang: 0x40c, script: 0x52, flags: 0x0},
-	271: {lang: 0x33e, script: 0x52, flags: 0x0},
-	272: {lang: 0x46, script: 0x2, flags: 0x1},
-	274: {lang: 0x1f1, script: 0x52, flags: 0x0},
-	275: {lang: 0x159, script: 0x52, flags: 0x0},
-	276: {lang: 0x41f, script: 0x52, flags: 0x0},
-	277: {lang: 0x35e, script: 0x52, flags: 0x0},
-	279: {lang: 0x3b7, script: 0x52, flags: 0x0},
-	281: {lang: 0x139, script: 0x52, flags: 0x0},
-	283: {lang: 0x48, script: 0x2, flags: 0x1},
-	287: {lang: 0x159, script: 0x52, flags: 0x0},
-	288: {lang: 0x159, script: 0x52, flags: 0x0},
-	289: {lang: 0x4a, script: 0x2, flags: 0x1},
-	290: {lang: 0x4c, script: 0x3, flags: 0x1},
-	291: {lang: 0x4f, script: 0x2, flags: 0x1},
-	292: {lang: 0x46d, script: 0x52, flags: 0x0},
-	293: {lang: 0x3b7, script: 0x52, flags: 0x0},
-	294: {lang: 0x46c, script: 0x52, flags: 0x0},
-	295: {lang: 0x51, script: 0x2, flags: 0x1},
-	296: {lang: 0x478, script: 0x52, flags: 0x0},
-	298: {lang: 0x53, script: 0x4, flags: 0x1},
-	300: {lang: 0x496, script: 0x52, flags: 0x0},
-	301: {lang: 0x57, script: 0x2, flags: 0x1},
-	302: {lang: 0x43b, script: 0x52, flags: 0x0},
-	303: {lang: 0x59, script: 0x3, flags: 0x1},
-	304: {lang: 0x43b, script: 0x52, flags: 0x0},
-	308: {lang: 0x508, script: 0x37, flags: 0x2},
-	309: {lang: 0x139, script: 0x52, flags: 0x0},
-	310: {lang: 0x4b2, script: 0x52, flags: 0x0},
-	311: {lang: 0x1f1, script: 0x52, flags: 0x0},
-	314: {lang: 0x139, script: 0x52, flags: 0x0},
-	317: {lang: 0x4b9, script: 0x52, flags: 0x0},
-	318: {lang: 0x89, script: 0x52, flags: 0x0},
-	319: {lang: 0x159, script: 0x52, flags: 0x0},
-	321: {lang: 0x411, script: 0x52, flags: 0x0},
-	332: {lang: 0x5c, script: 0x2, flags: 0x1},
-	349: {lang: 0x39, script: 0x5, flags: 0x0},
-	350: {lang: 0x5e, script: 0x2, flags: 0x1},
-	355: {lang: 0x419, script: 0x52, flags: 0x0},
-}
-
-// likelyRegionList holds lists info associated with likelyRegion.
-// Size: 384 bytes, 96 elements
-var likelyRegionList = [96]likelyLangScript{
-	0:  {lang: 0x143, script: 0x5, flags: 0x0},
-	1:  {lang: 0x46c, script: 0x52, flags: 0x0},
-	2:  {lang: 0x427, script: 0x52, flags: 0x0},
-	3:  {lang: 0x2f6, script: 0x1e, flags: 0x0},
-	4:  {lang: 0x1d0, script: 0x8, flags: 0x0},
-	5:  {lang: 0x26b, script: 0x52, flags: 0x0},
-	6:  {lang: 0xb5, script: 0x52, flags: 0x0},
-	7:  {lang: 0x428, script: 0x1e, flags: 0x0},
-	8:  {lang: 0x129, script: 0xd6, flags: 0x0},
-	9:  {lang: 0x348, script: 0x20, flags: 0x0},
-	10: {lang: 0x51f, script: 0x34, flags: 0x0},
-	11: {lang: 0x4a2, script: 0x5, flags: 0x0},
-	12: {lang: 0x515, script: 0x35, flags: 0x0},
-	13: {lang: 0x519, script: 0x52, flags: 0x0},
-	14: {lang: 0x291, script: 0xd5, flags: 0x0},
-	15: {lang: 0x131, script: 0x2d, flags: 0x0},
-	16: {lang: 0x480, script: 0x52, flags: 0x0},
-	17: {lang: 0x39, script: 0x5, flags: 0x0},
-	18: {lang: 0x159, script: 0x52, flags: 0x0},
-	19: {lang: 0x26, script: 0x27, flags: 0x0},
-	20: {lang: 0x134, script: 0x52, flags: 0x0},
-	21: {lang: 0x261, script: 0x5, flags: 0x2},
-	22: {lang: 0x508, script: 0x37, flags: 0x2},
-	23: {lang: 0x208, script: 0x29, flags: 0x0},
-	24: {lang: 0x5, script: 0x1e, flags: 0x0},
-	25: {lang: 0x26b, script: 0x52, flags: 0x0},
-	26: {lang: 0x131, script: 0x2d, flags: 0x0},
-	27: {lang: 0x2f6, script: 0x1e, flags: 0x0},
-	28: {lang: 0x1da, script: 0x52, flags: 0x0},
-	29: {lang: 0x316, script: 0x5, flags: 0x0},
-	30: {lang: 0x1b7, script: 0x20, flags: 0x0},
-	31: {lang: 0x4aa, script: 0x5, flags: 0x0},
-	32: {lang: 0x22e, script: 0x6b, flags: 0x0},
-	33: {lang: 0x143, script: 0x5, flags: 0x0},
-	34: {lang: 0x46c, script: 0x52, flags: 0x0},
-	35: {lang: 0x242, script: 0x46, flags: 0x0},
-	36: {lang: 0xe4, script: 0x5, flags: 0x0},
-	37: {lang: 0x21e, script: 0xd5, flags: 0x0},
-	38: {lang: 0x39, script: 0x5, flags: 0x0},
-	39: {lang: 0x159, script: 0x52, flags: 0x0},
-	40: {lang: 0x2af, script: 0x4f, flags: 0x0},
-	41: {lang: 0x21e, script: 0xd5, flags: 0x0},
-	42: {lang: 0x39, script: 0x5, flags: 0x0},
-	43: {lang: 0x159, script: 0x52, flags: 0x0},
-	44: {lang: 0x3d3, script: 0x52, flags: 0x0},
-	45: {lang: 0x4a4, script: 0x1e, flags: 0x0},
-	46: {lang: 0x2f6, script: 0x1e, flags: 0x0},
-	47: {lang: 0x427, script: 0x52, flags: 0x0},
-	48: {lang: 0x328, script: 0x6b, flags: 0x0},
-	49: {lang: 0x20b, script: 0x52, flags: 0x0},
-	50: {lang: 0x302, script: 0x1e, flags: 0x0},
-	51: {lang: 0x23a, script: 0x5, flags: 0x0},
-	52: {lang: 0x51f, script: 0x35, flags: 0x0},
-	53: {lang: 0x3b7, script: 0x52, flags: 0x0},
-	54: {lang: 0x39, script: 0x5, flags: 0x0},
-	55: {lang: 0x159, script: 0x52, flags: 0x0},
-	56: {lang: 0x2e4, script: 0x52, flags: 0x0},
-	57: {lang: 0x4aa, script: 0x5, flags: 0x0},
-	58: {lang: 0x87, script: 0x20, flags: 0x0},
-	59: {lang: 0x4aa, script: 0x5, flags: 0x0},
-	60: {lang: 0x4aa, script: 0x5, flags: 0x0},
-	61: {lang: 0xbc, script: 0x20, flags: 0x0},
-	62: {lang: 0x3aa, script: 0x52, flags: 0x0},
-	63: {lang: 0x70, script: 0x1e, flags: 0x0},
-	64: {lang: 0x3d3, script: 0x52, flags: 0x0},
-	65: {lang: 0x7d, script: 0x1e, flags: 0x0},
-	66: {lang: 0x3d9, script: 0x1e, flags: 0x0},
-	67: {lang: 0x25e, script: 0x52, flags: 0x0},
-	68: {lang: 0x43a, script: 0x52, flags: 0x0},
-	69: {lang: 0x508, script: 0x37, flags: 0x0},
-	70: {lang: 0x408, script: 0x52, flags: 0x0},
-	71: {lang: 0x4a4, script: 0x1e, flags: 0x0},
-	72: {lang: 0x39, script: 0x5, flags: 0x0},
-	73: {lang: 0x159, script: 0x52, flags: 0x0},
-	74: {lang: 0x159, script: 0x52, flags: 0x0},
-	75: {lang: 0x34, script: 0x5, flags: 0x0},
-	76: {lang: 0x461, script: 0xd5, flags: 0x0},
-	77: {lang: 0x2e3, script: 0x5, flags: 0x0},
-	78: {lang: 0x306, script: 0x6b, flags: 0x0},
-	79: {lang: 0x45d, script: 0x1e, flags: 0x0},
-	80: {lang: 0x143, script: 0x5, flags: 0x0},
-	81: {lang: 0x39, script: 0x5, flags: 0x0},
-	82: {lang: 0x159, script: 0x52, flags: 0x0},
-	83: {lang: 0x480, script: 0x52, flags: 0x0},
-	84: {lang: 0x57, script: 0x5, flags: 0x0},
-	85: {lang: 0x211, script: 0x1e, flags: 0x0},
-	86: {lang: 0x80, script: 0x2d, flags: 0x0},
-	87: {lang: 0x51f, script: 0x35, flags: 0x0},
-	88: {lang: 0x482, script: 0x52, flags: 0x0},
-	89: {lang: 0x4a4, script: 0x1e, flags: 0x0},
-	90: {lang: 0x508, script: 0x37, flags: 0x0},
-	91: {lang: 0x3aa, script: 0x52, flags: 0x0},
-	92: {lang: 0x427, script: 0x52, flags: 0x0},
-	93: {lang: 0x428, script: 0x1e, flags: 0x0},
-	94: {lang: 0x159, script: 0x52, flags: 0x0},
-	95: {lang: 0x43c, script: 0x5, flags: 0x0},
-}
-
-type likelyTag struct {
-	lang   uint16
-	region uint16
-	script uint8
-}
-
-// Size: 192 bytes, 32 elements
-var likelyRegionGroup = [32]likelyTag{
-	1:  {lang: 0x134, region: 0xd5, script: 0x52},
-	2:  {lang: 0x134, region: 0x134, script: 0x52},
-	3:  {lang: 0x3b7, region: 0x40, script: 0x52},
-	4:  {lang: 0x134, region: 0x2e, script: 0x52},
-	5:  {lang: 0x134, region: 0xd5, script: 0x52},
-	6:  {lang: 0x139, region: 0xce, script: 0x52},
-	7:  {lang: 0x43b, region: 0x12e, script: 0x52},
-	8:  {lang: 0x39, region: 0x6a, script: 0x5},
-	9:  {lang: 0x43b, region: 0x4a, script: 0x52},
-	10: {lang: 0x134, region: 0x160, script: 0x52},
-	11: {lang: 0x134, region: 0x134, script: 0x52},
-	12: {lang: 0x134, region: 0x134, script: 0x52},
-	13: {lang: 0x139, region: 0x58, script: 0x52},
-	14: {lang: 0x51f, region: 0x52, script: 0x34},
-	15: {lang: 0x1b7, region: 0x98, script: 0x20},
-	16: {lang: 0x1da, region: 0x94, script: 0x52},
-	17: {lang: 0x1f1, region: 0x9d, script: 0x52},
-	18: {lang: 0x134, region: 0x2e, script: 0x52},
-	19: {lang: 0x134, region: 0xe5, script: 0x52},
-	20: {lang: 0x134, region: 0x89, script: 0x52},
-	21: {lang: 0x411, region: 0x141, script: 0x52},
-	22: {lang: 0x51f, region: 0x52, script: 0x34},
-	23: {lang: 0x4b2, region: 0x136, script: 0x52},
-	24: {lang: 0x39, region: 0x107, script: 0x5},
-	25: {lang: 0x3d9, region: 0x105, script: 0x1e},
-	26: {lang: 0x3d9, region: 0x105, script: 0x1e},
-	27: {lang: 0x134, region: 0x7a, script: 0x52},
-	28: {lang: 0x109, region: 0x5f, script: 0x52},
-	29: {lang: 0x139, region: 0x1e, script: 0x52},
-	30: {lang: 0x134, region: 0x99, script: 0x52},
-	31: {lang: 0x134, region: 0x7a, script: 0x52},
-}
+var paradigmLocales = [][3]uint16{ // 3 elements
+	0: [3]uint16{0x139, 0x0, 0x7b},
+	1: [3]uint16{0x13e, 0x0, 0x1f},
+	2: [3]uint16{0x3c0, 0x41, 0xee},
+} // Size: 42 bytes
 
 type mutualIntelligibility struct {
-	want   uint16
-	have   uint16
-	conf   uint8
-	oneway bool
+	want     uint16
+	have     uint16
+	distance uint8
+	oneway   bool
 }
-
 type scriptIntelligibility struct {
-	lang uint16
-	want uint8
-	have uint8
-	conf uint8
+	wantLang   uint16
+	haveLang   uint16
+	wantScript uint8
+	haveScript uint8
+	distance   uint8
+}
+type regionIntelligibility struct {
+	lang     uint16
+	script   uint8
+	group    uint8
+	distance uint8
 }
 
 // matchLang holds pairs of langIDs of base languages that are typically
 // mutually intelligible. Each pair is associated with a confidence and
 // whether the intelligibility goes one or both ways.
-// Size: 708 bytes, 118 elements
-var matchLang = [118]mutualIntelligibility{
-	0:   {want: 0x366, have: 0x33e, conf: 0x2, oneway: false},
-	1:   {want: 0x26b, have: 0xe7, conf: 0x2, oneway: false},
-	2:   {want: 0x1ca, have: 0xb5, conf: 0x2, oneway: false},
-	3:   {want: 0x3fd, have: 0xb5, conf: 0x2, oneway: false},
-	4:   {want: 0x428, have: 0xb5, conf: 0x2, oneway: false},
-	5:   {want: 0x3fd, have: 0x1ca, conf: 0x2, oneway: false},
-	6:   {want: 0x428, have: 0x1ca, conf: 0x2, oneway: false},
-	7:   {want: 0x3fd, have: 0x428, conf: 0x2, oneway: false},
-	8:   {want: 0x430, have: 0x1, conf: 0x2, oneway: false},
-	9:   {want: 0x19c, have: 0x109, conf: 0x2, oneway: true},
-	10:  {want: 0x28c, have: 0x109, conf: 0x2, oneway: true},
-	11:  {want: 0xfd, have: 0x366, conf: 0x2, oneway: false},
-	12:  {want: 0xfd, have: 0x33e, conf: 0x2, oneway: false},
-	13:  {want: 0xe7, have: 0x26b, conf: 0x2, oneway: false},
-	14:  {want: 0x5, have: 0x3d9, conf: 0x2, oneway: true},
-	15:  {want: 0xc, have: 0x134, conf: 0x2, oneway: true},
-	16:  {want: 0x15, have: 0x35e, conf: 0x2, oneway: true},
-	17:  {want: 0x20, have: 0x134, conf: 0x2, oneway: true},
-	18:  {want: 0x55, have: 0x139, conf: 0x2, oneway: true},
-	19:  {want: 0x57, have: 0x3d9, conf: 0x2, oneway: true},
-	20:  {want: 0x70, have: 0x3d9, conf: 0x2, oneway: true},
-	21:  {want: 0x74, have: 0x134, conf: 0x2, oneway: true},
-	22:  {want: 0x81, have: 0x1b7, conf: 0x2, oneway: true},
-	23:  {want: 0xa3, have: 0x134, conf: 0x2, oneway: true},
-	24:  {want: 0xb0, have: 0x159, conf: 0x2, oneway: true},
-	25:  {want: 0xdb, have: 0x14e, conf: 0x2, oneway: true},
-	26:  {want: 0xe3, have: 0x134, conf: 0x2, oneway: true},
-	27:  {want: 0xe7, have: 0x39, conf: 0x2, oneway: true},
-	28:  {want: 0xed, have: 0x159, conf: 0x2, oneway: true},
-	29:  {want: 0xf5, have: 0x159, conf: 0x2, oneway: true},
-	30:  {want: 0xfc, have: 0x134, conf: 0x2, oneway: true},
-	31:  {want: 0x12c, have: 0x134, conf: 0x2, oneway: true},
-	32:  {want: 0x137, have: 0x134, conf: 0x2, oneway: true},
-	33:  {want: 0x13b, have: 0x14c, conf: 0x2, oneway: true},
-	34:  {want: 0x140, have: 0x139, conf: 0x2, oneway: true},
-	35:  {want: 0x153, have: 0xfd, conf: 0x2, oneway: true},
-	36:  {want: 0x168, have: 0x35e, conf: 0x2, oneway: true},
-	37:  {want: 0x169, have: 0x134, conf: 0x2, oneway: true},
-	38:  {want: 0x16a, have: 0x134, conf: 0x2, oneway: true},
-	39:  {want: 0x178, have: 0x134, conf: 0x2, oneway: true},
-	40:  {want: 0x18a, have: 0x139, conf: 0x2, oneway: true},
-	41:  {want: 0x18e, have: 0x139, conf: 0x2, oneway: true},
-	42:  {want: 0x19d, have: 0x1b7, conf: 0x2, oneway: true},
-	43:  {want: 0x1ad, have: 0x134, conf: 0x2, oneway: true},
-	44:  {want: 0x1b1, have: 0x134, conf: 0x2, oneway: true},
-	45:  {want: 0x1cd, have: 0x159, conf: 0x2, oneway: true},
-	46:  {want: 0x1d0, have: 0x3d9, conf: 0x2, oneway: true},
-	47:  {want: 0x1d2, have: 0x134, conf: 0x2, oneway: true},
-	48:  {want: 0x1df, have: 0x134, conf: 0x2, oneway: true},
-	49:  {want: 0x1f0, have: 0x134, conf: 0x2, oneway: true},
-	50:  {want: 0x206, have: 0x1da, conf: 0x2, oneway: true},
-	51:  {want: 0x208, have: 0x134, conf: 0x2, oneway: true},
-	52:  {want: 0x225, have: 0x159, conf: 0x2, oneway: true},
-	53:  {want: 0x23a, have: 0x3d9, conf: 0x2, oneway: true},
-	54:  {want: 0x242, have: 0x134, conf: 0x2, oneway: true},
-	55:  {want: 0x249, have: 0x134, conf: 0x2, oneway: true},
-	56:  {want: 0x25c, have: 0x134, conf: 0x2, oneway: true},
-	57:  {want: 0x26b, have: 0x480, conf: 0x2, oneway: true},
-	58:  {want: 0x281, have: 0x3d9, conf: 0x2, oneway: true},
-	59:  {want: 0x285, have: 0x1f1, conf: 0x2, oneway: true},
-	60:  {want: 0x29a, have: 0x134, conf: 0x2, oneway: true},
-	61:  {want: 0x2ac, have: 0x159, conf: 0x2, oneway: true},
-	62:  {want: 0x2af, have: 0x134, conf: 0x2, oneway: true},
-	63:  {want: 0x2b5, have: 0x134, conf: 0x2, oneway: true},
-	64:  {want: 0x2ba, have: 0x159, conf: 0x2, oneway: true},
-	65:  {want: 0x2e4, have: 0x134, conf: 0x2, oneway: true},
-	66:  {want: 0x2e8, have: 0x159, conf: 0x2, oneway: true},
-	67:  {want: 0x2f1, have: 0x134, conf: 0x2, oneway: true},
-	68:  {want: 0x2f6, have: 0x7d, conf: 0x2, oneway: true},
-	69:  {want: 0x2fb, have: 0x134, conf: 0x2, oneway: true},
-	70:  {want: 0x302, have: 0x3d9, conf: 0x2, oneway: true},
-	71:  {want: 0x312, have: 0x1b7, conf: 0x2, oneway: true},
-	72:  {want: 0x316, have: 0x1da, conf: 0x2, oneway: true},
-	73:  {want: 0x317, have: 0x134, conf: 0x2, oneway: true},
-	74:  {want: 0x328, have: 0x134, conf: 0x2, oneway: true},
-	75:  {want: 0x348, have: 0x134, conf: 0x2, oneway: true},
-	76:  {want: 0x361, have: 0x33e, conf: 0x2, oneway: false},
-	77:  {want: 0x361, have: 0x366, conf: 0x2, oneway: true},
-	78:  {want: 0x371, have: 0x134, conf: 0x2, oneway: true},
-	79:  {want: 0x37e, have: 0x134, conf: 0x2, oneway: true},
-	80:  {want: 0x380, have: 0x134, conf: 0x2, oneway: true},
-	81:  {want: 0x382, have: 0x159, conf: 0x2, oneway: true},
-	82:  {want: 0x387, have: 0x134, conf: 0x2, oneway: true},
-	83:  {want: 0x38c, have: 0x134, conf: 0x2, oneway: true},
-	84:  {want: 0x394, have: 0x134, conf: 0x2, oneway: true},
-	85:  {want: 0x39c, have: 0x134, conf: 0x2, oneway: true},
-	86:  {want: 0x3b5, have: 0x134, conf: 0x2, oneway: true},
-	87:  {want: 0x3bb, have: 0x139, conf: 0x2, oneway: true},
-	88:  {want: 0x3cb, have: 0x109, conf: 0x2, oneway: true},
-	89:  {want: 0x3d0, have: 0x134, conf: 0x2, oneway: true},
-	90:  {want: 0x3dc, have: 0x159, conf: 0x2, oneway: true},
-	91:  {want: 0x3e0, have: 0x1b7, conf: 0x2, oneway: true},
-	92:  {want: 0x3f0, have: 0x134, conf: 0x2, oneway: true},
-	93:  {want: 0x402, have: 0x134, conf: 0x2, oneway: true},
-	94:  {want: 0x419, have: 0x134, conf: 0x2, oneway: true},
-	95:  {want: 0x41f, have: 0x134, conf: 0x2, oneway: true},
-	96:  {want: 0x427, have: 0x134, conf: 0x2, oneway: true},
-	97:  {want: 0x431, have: 0x134, conf: 0x2, oneway: true},
-	98:  {want: 0x434, have: 0x1da, conf: 0x2, oneway: true},
-	99:  {want: 0x43b, have: 0x134, conf: 0x2, oneway: true},
-	100: {want: 0x446, have: 0x134, conf: 0x2, oneway: true},
-	101: {want: 0x457, have: 0x134, conf: 0x2, oneway: true},
-	102: {want: 0x45d, have: 0x3d9, conf: 0x2, oneway: true},
-	103: {want: 0x465, have: 0x134, conf: 0x2, oneway: true},
-	104: {want: 0x46c, have: 0x3d9, conf: 0x2, oneway: true},
-	105: {want: 0x3878, have: 0x134, conf: 0x2, oneway: true},
-	106: {want: 0x476, have: 0x134, conf: 0x2, oneway: true},
-	107: {want: 0x478, have: 0x134, conf: 0x2, oneway: true},
-	108: {want: 0x48a, have: 0x3d9, conf: 0x2, oneway: true},
-	109: {want: 0x493, have: 0x134, conf: 0x2, oneway: true},
-	110: {want: 0x4a2, have: 0x51f, conf: 0x2, oneway: true},
-	111: {want: 0x4aa, have: 0x134, conf: 0x2, oneway: true},
-	112: {want: 0x4b2, have: 0x3d9, conf: 0x2, oneway: true},
-	113: {want: 0x4db, have: 0x159, conf: 0x2, oneway: true},
-	114: {want: 0x4e8, have: 0x134, conf: 0x2, oneway: true},
-	115: {want: 0x508, have: 0x134, conf: 0x2, oneway: true},
-	116: {want: 0x50e, have: 0x134, conf: 0x2, oneway: true},
-	117: {want: 0x524, have: 0x134, conf: 0x2, oneway: true},
-}
+var matchLang = []mutualIntelligibility{ // 113 elements
+	0:   {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false},
+	1:   {want: 0x407, have: 0xb7, distance: 0x4, oneway: false},
+	2:   {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false},
+	3:   {want: 0x407, have: 0x432, distance: 0x4, oneway: false},
+	4:   {want: 0x43a, have: 0x1, distance: 0x4, oneway: false},
+	5:   {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true},
+	6:   {want: 0x295, have: 0x10d, distance: 0x4, oneway: true},
+	7:   {want: 0x101, have: 0x36f, distance: 0x8, oneway: false},
+	8:   {want: 0x101, have: 0x347, distance: 0x8, oneway: false},
+	9:   {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true},
+	10:  {want: 0xd, have: 0x139, distance: 0xa, oneway: true},
+	11:  {want: 0x16, have: 0x367, distance: 0xa, oneway: true},
+	12:  {want: 0x21, have: 0x139, distance: 0xa, oneway: true},
+	13:  {want: 0x56, have: 0x13e, distance: 0xa, oneway: true},
+	14:  {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true},
+	15:  {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true},
+	16:  {want: 0x75, have: 0x139, distance: 0xa, oneway: true},
+	17:  {want: 0x82, have: 0x1be, distance: 0xa, oneway: true},
+	18:  {want: 0xa5, have: 0x139, distance: 0xa, oneway: true},
+	19:  {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true},
+	20:  {want: 0xdd, have: 0x153, distance: 0xa, oneway: true},
+	21:  {want: 0xe5, have: 0x139, distance: 0xa, oneway: true},
+	22:  {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true},
+	23:  {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true},
+	24:  {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true},
+	25:  {want: 0x100, have: 0x139, distance: 0xa, oneway: true},
+	26:  {want: 0x130, have: 0x139, distance: 0xa, oneway: true},
+	27:  {want: 0x13c, have: 0x139, distance: 0xa, oneway: true},
+	28:  {want: 0x140, have: 0x151, distance: 0xa, oneway: true},
+	29:  {want: 0x145, have: 0x13e, distance: 0xa, oneway: true},
+	30:  {want: 0x158, have: 0x101, distance: 0xa, oneway: true},
+	31:  {want: 0x16d, have: 0x367, distance: 0xa, oneway: true},
+	32:  {want: 0x16e, have: 0x139, distance: 0xa, oneway: true},
+	33:  {want: 0x16f, have: 0x139, distance: 0xa, oneway: true},
+	34:  {want: 0x17e, have: 0x139, distance: 0xa, oneway: true},
+	35:  {want: 0x190, have: 0x13e, distance: 0xa, oneway: true},
+	36:  {want: 0x194, have: 0x13e, distance: 0xa, oneway: true},
+	37:  {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true},
+	38:  {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true},
+	39:  {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true},
+	40:  {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true},
+	41:  {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true},
+	42:  {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true},
+	43:  {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true},
+	44:  {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true},
+	45:  {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true},
+	46:  {want: 0x210, have: 0x139, distance: 0xa, oneway: true},
+	47:  {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true},
+	48:  {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true},
+	49:  {want: 0x24a, have: 0x139, distance: 0xa, oneway: true},
+	50:  {want: 0x251, have: 0x139, distance: 0xa, oneway: true},
+	51:  {want: 0x265, have: 0x139, distance: 0xa, oneway: true},
+	52:  {want: 0x274, have: 0x48a, distance: 0xa, oneway: true},
+	53:  {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true},
+	54:  {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true},
+	55:  {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true},
+	56:  {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true},
+	57:  {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true},
+	58:  {want: 0x2be, have: 0x139, distance: 0xa, oneway: true},
+	59:  {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true},
+	60:  {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true},
+	61:  {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true},
+	62:  {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true},
+	63:  {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true},
+	64:  {want: 0x304, have: 0x139, distance: 0xa, oneway: true},
+	65:  {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true},
+	66:  {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true},
+	67:  {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true},
+	68:  {want: 0x320, have: 0x139, distance: 0xa, oneway: true},
+	69:  {want: 0x331, have: 0x139, distance: 0xa, oneway: true},
+	70:  {want: 0x351, have: 0x139, distance: 0xa, oneway: true},
+	71:  {want: 0x36a, have: 0x347, distance: 0xa, oneway: false},
+	72:  {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true},
+	73:  {want: 0x37a, have: 0x139, distance: 0xa, oneway: true},
+	74:  {want: 0x387, have: 0x139, distance: 0xa, oneway: true},
+	75:  {want: 0x389, have: 0x139, distance: 0xa, oneway: true},
+	76:  {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true},
+	77:  {want: 0x390, have: 0x139, distance: 0xa, oneway: true},
+	78:  {want: 0x395, have: 0x139, distance: 0xa, oneway: true},
+	79:  {want: 0x39d, have: 0x139, distance: 0xa, oneway: true},
+	80:  {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true},
+	81:  {want: 0x3be, have: 0x139, distance: 0xa, oneway: true},
+	82:  {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true},
+	83:  {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true},
+	84:  {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true},
+	85:  {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true},
+	86:  {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true},
+	87:  {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true},
+	88:  {want: 0x40c, have: 0x139, distance: 0xa, oneway: true},
+	89:  {want: 0x423, have: 0x139, distance: 0xa, oneway: true},
+	90:  {want: 0x429, have: 0x139, distance: 0xa, oneway: true},
+	91:  {want: 0x431, have: 0x139, distance: 0xa, oneway: true},
+	92:  {want: 0x43b, have: 0x139, distance: 0xa, oneway: true},
+	93:  {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true},
+	94:  {want: 0x445, have: 0x139, distance: 0xa, oneway: true},
+	95:  {want: 0x450, have: 0x139, distance: 0xa, oneway: true},
+	96:  {want: 0x461, have: 0x139, distance: 0xa, oneway: true},
+	97:  {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true},
+	98:  {want: 0x46f, have: 0x139, distance: 0xa, oneway: true},
+	99:  {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true},
+	100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true},
+	101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true},
+	102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true},
+	103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true},
+	104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true},
+	105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true},
+	106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true},
+	107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true},
+	108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true},
+	109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true},
+	110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true},
+	111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true},
+	112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true},
+} // Size: 702 bytes
 
 // matchScript holds pairs of scriptIDs where readers of one script
 // can typically also read the other. Each is associated with a confidence.
-// Size: 24 bytes, 4 elements
-var matchScript = [4]scriptIntelligibility{
-	0: {lang: 0x428, want: 0x52, have: 0x1e, conf: 0x2},
-	1: {lang: 0x428, want: 0x1e, have: 0x52, conf: 0x2},
-	2: {lang: 0x0, want: 0x34, have: 0x35, conf: 0x1},
-	3: {lang: 0x0, want: 0x35, have: 0x34, conf: 0x1},
-}
-
-// Size: 128 bytes, 32 elements
-var regionContainment = [32]uint32{
-	0xffffffff, 0x000007a2, 0x00003044, 0x00000008,
-	0x403c0010, 0x00000020, 0x00000040, 0x00000080,
-	0x00000100, 0x00000200, 0x00000400, 0x2000384c,
-	0x00001000, 0x00002000, 0x00004000, 0x00008000,
-	0x00010000, 0x00020000, 0x00040000, 0x00080000,
-	0x00100000, 0x00200000, 0x01c1c000, 0x00800000,
-	0x01000000, 0x1e020000, 0x04000000, 0x08000000,
-	0x10000000, 0x20002048, 0x40000000, 0x80000000,
-}
-
-// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
-// where each set holds all groupings that are directly connected in a region
-// containment graph.
-// Size: 357 bytes, 357 elements
-var regionInclusion = [357]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
-	0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
-	0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
-	0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x20,
-	0x21, 0x22, 0x23, 0x24, 0x25, 0x25, 0x22, 0x23,
-	0x25, 0x26, 0x21, 0x27, 0x28, 0x29, 0x2a, 0x25,
-	0x2b, 0x23, 0x22, 0x25, 0x24, 0x29, 0x2c, 0x2d,
-	0x23, 0x2e, 0x2c, 0x25, 0x2f, 0x30, 0x27, 0x25,
-	// Entry 40 - 7F
-	0x27, 0x25, 0x24, 0x30, 0x21, 0x31, 0x32, 0x33,
-	0x2f, 0x21, 0x26, 0x26, 0x26, 0x34, 0x2c, 0x28,
-	0x27, 0x26, 0x35, 0x27, 0x21, 0x33, 0x22, 0x20,
-	0x25, 0x2c, 0x25, 0x21, 0x36, 0x2d, 0x34, 0x29,
-	0x21, 0x2e, 0x37, 0x25, 0x25, 0x20, 0x38, 0x38,
-	0x27, 0x37, 0x38, 0x38, 0x2e, 0x39, 0x2e, 0x1f,
-	0x20, 0x37, 0x3a, 0x27, 0x3b, 0x2b, 0x20, 0x29,
-	0x34, 0x26, 0x37, 0x25, 0x23, 0x27, 0x2b, 0x2c,
-	// Entry 80 - BF
-	0x22, 0x2f, 0x2c, 0x2c, 0x25, 0x26, 0x39, 0x21,
-	0x33, 0x3b, 0x2c, 0x27, 0x35, 0x21, 0x33, 0x39,
-	0x25, 0x2d, 0x20, 0x38, 0x30, 0x37, 0x23, 0x2b,
-	0x24, 0x21, 0x23, 0x24, 0x2b, 0x39, 0x2b, 0x25,
-	0x23, 0x35, 0x20, 0x2e, 0x3c, 0x30, 0x3b, 0x2e,
-	0x25, 0x35, 0x35, 0x23, 0x25, 0x3c, 0x30, 0x23,
-	0x25, 0x34, 0x24, 0x2c, 0x31, 0x37, 0x29, 0x37,
-	0x38, 0x38, 0x34, 0x32, 0x22, 0x25, 0x2e, 0x3b,
-	// Entry C0 - FF
-	0x20, 0x22, 0x2c, 0x30, 0x35, 0x35, 0x3b, 0x25,
-	0x2c, 0x25, 0x39, 0x2e, 0x24, 0x2e, 0x33, 0x30,
-	0x2e, 0x31, 0x3a, 0x2c, 0x2a, 0x2c, 0x20, 0x33,
-	0x29, 0x2b, 0x24, 0x20, 0x3b, 0x23, 0x28, 0x2a,
-	0x23, 0x33, 0x20, 0x27, 0x28, 0x3a, 0x30, 0x24,
-	0x2d, 0x2f, 0x28, 0x25, 0x23, 0x39, 0x20, 0x3b,
-	0x27, 0x20, 0x23, 0x20, 0x20, 0x1e, 0x20, 0x20,
-	0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20,
-	// Entry 100 - 13F
-	0x20, 0x2e, 0x20, 0x2d, 0x22, 0x32, 0x2e, 0x23,
-	0x3a, 0x2e, 0x38, 0x37, 0x30, 0x2c, 0x39, 0x2b,
-	0x2d, 0x2c, 0x22, 0x2c, 0x2e, 0x27, 0x2e, 0x26,
-	0x32, 0x33, 0x25, 0x23, 0x31, 0x21, 0x25, 0x26,
-	0x21, 0x2c, 0x30, 0x3c, 0x28, 0x30, 0x3c, 0x38,
-	0x28, 0x30, 0x23, 0x25, 0x28, 0x35, 0x2e, 0x32,
-	0x2e, 0x20, 0x21, 0x20, 0x2f, 0x27, 0x3c, 0x22,
-	0x25, 0x20, 0x27, 0x25, 0x25, 0x30, 0x3a, 0x28,
-	// Entry 140 - 17F
-	0x20, 0x28, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20,
-	0x20, 0x20, 0x20, 0x20, 0x22, 0x20, 0x20, 0x20,
-	0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20,
-	0x20, 0x20, 0x20, 0x20, 0x23, 0x23, 0x2e, 0x22,
-	0x31, 0x2e, 0x26, 0x2e, 0x20,
-}
-
-// regionInclusionBits is an array of bit vectors where every vector represents
-// a set of region groupings.  These sets are used to compute the distance
-// between two regions for the purpose of language matching.
-// Size: 288 bytes, 72 elements
-var regionInclusionBits = [72]uint32{
-	// Entry 0 - 1F
-	0x82400813, 0x000007a3, 0x00003844, 0x20000808,
-	0x403c0011, 0x00000022, 0x20000844, 0x00000082,
-	0x00000102, 0x00000202, 0x00000402, 0x2000384d,
-	0x00001804, 0x20002804, 0x00404000, 0x00408000,
-	0x00410000, 0x02020000, 0x00040010, 0x00080010,
-	0x00100010, 0x00200010, 0x01c1c001, 0x00c00000,
-	0x01400000, 0x1e020001, 0x06000000, 0x0a000000,
-	0x12000000, 0x20002848, 0x40000010, 0x80000001,
-	// Entry 20 - 3F
-	0x00000001, 0x40000000, 0x00020000, 0x01000000,
-	0x00008000, 0x00002000, 0x00000200, 0x00000008,
-	0x00200000, 0x90000000, 0x00040000, 0x08000000,
-	0x00000020, 0x84000000, 0x00000080, 0x00001000,
-	0x00010000, 0x00000400, 0x04000000, 0x00000040,
-	0x10000000, 0x00004000, 0x81000000, 0x88000000,
-	0x00000100, 0x80020000, 0x00080000, 0x00100000,
-	0x00800000, 0xffffffff, 0x82400fb3, 0xc27c0813,
-	// Entry 40 - 5F
-	0xa240385f, 0x83c1c813, 0x9e420813, 0x92000001,
-	0x86000001, 0x81400001, 0x8a000001, 0x82020001,
-}
-
-// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
-// all groups that are reachable from the groups set in the respective entry.
-// Size: 72 bytes, 72 elements
-var regionInclusionNext = [72]uint8{
-	// Entry 0 - 3F
-	0x3d, 0x3e, 0x0b, 0x0b, 0x3f, 0x01, 0x0b, 0x01,
-	0x01, 0x01, 0x01, 0x40, 0x0b, 0x0b, 0x16, 0x16,
-	0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x41, 0x16,
-	0x16, 0x42, 0x19, 0x19, 0x19, 0x0b, 0x04, 0x00,
-	0x00, 0x1e, 0x11, 0x18, 0x0f, 0x0d, 0x09, 0x03,
-	0x15, 0x43, 0x12, 0x1b, 0x05, 0x44, 0x07, 0x0c,
-	0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x45, 0x46,
-	0x08, 0x47, 0x13, 0x14, 0x17, 0x3d, 0x3d, 0x3d,
-	// Entry 40 - 7F
-	0x3d, 0x3d, 0x3d, 0x42, 0x42, 0x41, 0x42, 0x42,
-}
-
-type parentRel struct {
-	lang       uint16
-	script     uint8
-	maxScript  uint8
-	toRegion   uint16
-	fromRegion []uint16
-}
-
-// Size: 412 bytes, 5 elements
-var parents = [5]parentRel{
-	0: {lang: 0x134, script: 0x0, maxScript: 0x52, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x24, 0x25, 0x2e, 0x33, 0x35, 0x3c, 0x41, 0x45, 0x47, 0x48, 0x49, 0x4f, 0x51, 0x5b, 0x5c, 0x60, 0x63, 0x6c, 0x72, 0x73, 0x74, 0x7a, 0x7b, 0x7e, 0x7f, 0x80, 0x82, 0x8b, 0x8c, 0x95, 0x96, 0x97, 0x98, 0x99, 0x9e, 0x9f, 0xa3, 0xa6, 0xa8, 0xac, 0xb0, 0xb3, 0xb4, 0xbe, 0xc5, 0xc9, 0xca, 0xcb, 0xcd, 0xcf, 0xd1, 0xd4, 0xd5, 0xdc, 0xde, 0xdf, 0xe5, 0xe6, 0xe7, 0xea, 0xef, 0x106, 0x108, 0x109, 0x10a, 0x10c, 0x10d, 0x111, 0x116, 0x11a, 0x11c, 0x11e, 0x124, 0x128, 0x12b, 0x12c, 0x12e, 0x130, 0x138, 0x13b, 0x13e, 0x141, 0x160, 0x161, 0x163}},
-	1: {lang: 0x134, script: 0x0, maxScript: 0x52, toRegion: 0x1a, fromRegion: []uint16{0x2d, 0x4d, 0x5f, 0x62, 0x71, 0xd8, 0x10b, 0x10e}},
-	2: {lang: 0x139, script: 0x0, maxScript: 0x52, toRegion: 0x1e, fromRegion: []uint16{0x2b, 0x3e, 0x40, 0x50, 0x53, 0x55, 0x58, 0x64, 0x68, 0x88, 0x8e, 0xce, 0xd7, 0xe1, 0xe3, 0xeb, 0xf0, 0x119, 0x134, 0x135, 0x13a}},
-	3: {lang: 0x3b7, script: 0x0, maxScript: 0x52, toRegion: 0xed, fromRegion: []uint16{0x29, 0x4d, 0x59, 0x85, 0x8a, 0xb6, 0xc5, 0xd0, 0x117, 0x125}},
-	4: {lang: 0x51f, script: 0x35, maxScript: 0x35, toRegion: 0x8c, fromRegion: []uint16{0xc5}},
-}
-
-// Total table size 25825 bytes (25KiB); checksum: 4E97CC5E
+var matchScript = []scriptIntelligibility{ // 26 elements
+	0:  {wantLang: 0x432, haveLang: 0x432, wantScript: 0x57, haveScript: 0x1f, distance: 0x5},
+	1:  {wantLang: 0x432, haveLang: 0x432, wantScript: 0x1f, haveScript: 0x57, distance: 0x5},
+	2:  {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
+	3:  {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x57, distance: 0xa},
+	4:  {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x1f, distance: 0xa},
+	5:  {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2b, haveScript: 0x57, distance: 0xa},
+	6:  {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4b, haveScript: 0x57, distance: 0xa},
+	7:  {wantLang: 0x251, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x57, distance: 0xa},
+	8:  {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x54, haveScript: 0x57, distance: 0xa},
+	9:  {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6b, haveScript: 0x57, distance: 0xa},
+	10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x72, haveScript: 0x57, distance: 0xa},
+	11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x21, haveScript: 0x57, distance: 0xa},
+	12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x7d, haveScript: 0x57, distance: 0xa},
+	13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x33, haveScript: 0x57, distance: 0xa},
+	14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa},
+	15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa},
+	16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xca, haveScript: 0x57, distance: 0xa},
+	17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xd7, haveScript: 0x57, distance: 0xa},
+	18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xda, haveScript: 0x57, distance: 0xa},
+	19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x29, haveScript: 0x57, distance: 0xa},
+	20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
+	21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa},
+	22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
+	23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3b, haveScript: 0x57, distance: 0xa},
+	24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x38, haveScript: 0x39, distance: 0xf},
+	25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x39, haveScript: 0x38, distance: 0x13},
+} // Size: 232 bytes
+
+var matchRegion = []regionIntelligibility{ // 15 elements
+	0:  {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4},
+	1:  {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4},
+	2:  {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4},
+	3:  {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4},
+	4:  {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4},
+	5:  {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4},
+	6:  {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4},
+	7:  {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4},
+	8:  {lang: 0x529, script: 0x39, group: 0x2, distance: 0x4},
+	9:  {lang: 0x529, script: 0x39, group: 0x82, distance: 0x4},
+	10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5},
+	11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5},
+	12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5},
+	13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5},
+	14: {lang: 0x529, script: 0x39, group: 0x80, distance: 0x5},
+} // Size: 114 bytes
+
+// Total table size 1471 bytes (1KiB); checksum: 4CB1CD46
diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go
index de30155a2..42ea79266 100644
--- a/vendor/golang.org/x/text/language/tags.go
+++ b/vendor/golang.org/x/text/language/tags.go
@@ -4,6 +4,8 @@
 
 package language
 
+import "golang.org/x/text/internal/language/compact"
+
 // TODO: Various sets of commonly use tags and regions.
 
 // MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
@@ -61,83 +63,83 @@ var (
 
 	Und Tag = Tag{}
 
-	Afrikaans            Tag = Tag{lang: _af}                //  af
-	Amharic              Tag = Tag{lang: _am}                //  am
-	Arabic               Tag = Tag{lang: _ar}                //  ar
-	ModernStandardArabic Tag = Tag{lang: _ar, region: _001}  //  ar-001
-	Azerbaijani          Tag = Tag{lang: _az}                //  az
-	Bulgarian            Tag = Tag{lang: _bg}                //  bg
-	Bengali              Tag = Tag{lang: _bn}                //  bn
-	Catalan              Tag = Tag{lang: _ca}                //  ca
-	Czech                Tag = Tag{lang: _cs}                //  cs
-	Danish               Tag = Tag{lang: _da}                //  da
-	German               Tag = Tag{lang: _de}                //  de
-	Greek                Tag = Tag{lang: _el}                //  el
-	English              Tag = Tag{lang: _en}                //  en
-	AmericanEnglish      Tag = Tag{lang: _en, region: _US}   //  en-US
-	BritishEnglish       Tag = Tag{lang: _en, region: _GB}   //  en-GB
-	Spanish              Tag = Tag{lang: _es}                //  es
-	EuropeanSpanish      Tag = Tag{lang: _es, region: _ES}   //  es-ES
-	LatinAmericanSpanish Tag = Tag{lang: _es, region: _419}  //  es-419
-	Estonian             Tag = Tag{lang: _et}                //  et
-	Persian              Tag = Tag{lang: _fa}                //  fa
-	Finnish              Tag = Tag{lang: _fi}                //  fi
-	Filipino             Tag = Tag{lang: _fil}               //  fil
-	French               Tag = Tag{lang: _fr}                //  fr
-	CanadianFrench       Tag = Tag{lang: _fr, region: _CA}   //  fr-CA
-	Gujarati             Tag = Tag{lang: _gu}                //  gu
-	Hebrew               Tag = Tag{lang: _he}                //  he
-	Hindi                Tag = Tag{lang: _hi}                //  hi
-	Croatian             Tag = Tag{lang: _hr}                //  hr
-	Hungarian            Tag = Tag{lang: _hu}                //  hu
-	Armenian             Tag = Tag{lang: _hy}                //  hy
-	Indonesian           Tag = Tag{lang: _id}                //  id
-	Icelandic            Tag = Tag{lang: _is}                //  is
-	Italian              Tag = Tag{lang: _it}                //  it
-	Japanese             Tag = Tag{lang: _ja}                //  ja
-	Georgian             Tag = Tag{lang: _ka}                //  ka
-	Kazakh               Tag = Tag{lang: _kk}                //  kk
-	Khmer                Tag = Tag{lang: _km}                //  km
-	Kannada              Tag = Tag{lang: _kn}                //  kn
-	Korean               Tag = Tag{lang: _ko}                //  ko
-	Kirghiz              Tag = Tag{lang: _ky}                //  ky
-	Lao                  Tag = Tag{lang: _lo}                //  lo
-	Lithuanian           Tag = Tag{lang: _lt}                //  lt
-	Latvian              Tag = Tag{lang: _lv}                //  lv
-	Macedonian           Tag = Tag{lang: _mk}                //  mk
-	Malayalam            Tag = Tag{lang: _ml}                //  ml
-	Mongolian            Tag = Tag{lang: _mn}                //  mn
-	Marathi              Tag = Tag{lang: _mr}                //  mr
-	Malay                Tag = Tag{lang: _ms}                //  ms
-	Burmese              Tag = Tag{lang: _my}                //  my
-	Nepali               Tag = Tag{lang: _ne}                //  ne
-	Dutch                Tag = Tag{lang: _nl}                //  nl
-	Norwegian            Tag = Tag{lang: _no}                //  no
-	Punjabi              Tag = Tag{lang: _pa}                //  pa
-	Polish               Tag = Tag{lang: _pl}                //  pl
-	Portuguese           Tag = Tag{lang: _pt}                //  pt
-	BrazilianPortuguese  Tag = Tag{lang: _pt, region: _BR}   //  pt-BR
-	EuropeanPortuguese   Tag = Tag{lang: _pt, region: _PT}   //  pt-PT
-	Romanian             Tag = Tag{lang: _ro}                //  ro
-	Russian              Tag = Tag{lang: _ru}                //  ru
-	Sinhala              Tag = Tag{lang: _si}                //  si
-	Slovak               Tag = Tag{lang: _sk}                //  sk
-	Slovenian            Tag = Tag{lang: _sl}                //  sl
-	Albanian             Tag = Tag{lang: _sq}                //  sq
-	Serbian              Tag = Tag{lang: _sr}                //  sr
-	SerbianLatin         Tag = Tag{lang: _sr, script: _Latn} //  sr-Latn
-	Swedish              Tag = Tag{lang: _sv}                //  sv
-	Swahili              Tag = Tag{lang: _sw}                //  sw
-	Tamil                Tag = Tag{lang: _ta}                //  ta
-	Telugu               Tag = Tag{lang: _te}                //  te
-	Thai                 Tag = Tag{lang: _th}                //  th
-	Turkish              Tag = Tag{lang: _tr}                //  tr
-	Ukrainian            Tag = Tag{lang: _uk}                //  uk
-	Urdu                 Tag = Tag{lang: _ur}                //  ur
-	Uzbek                Tag = Tag{lang: _uz}                //  uz
-	Vietnamese           Tag = Tag{lang: _vi}                //  vi
-	Chinese              Tag = Tag{lang: _zh}                //  zh
-	SimplifiedChinese    Tag = Tag{lang: _zh, script: _Hans} //  zh-Hans
-	TraditionalChinese   Tag = Tag{lang: _zh, script: _Hant} //  zh-Hant
-	Zulu                 Tag = Tag{lang: _zu}                //  zu
+	Afrikaans            Tag = Tag(compact.Afrikaans)
+	Amharic              Tag = Tag(compact.Amharic)
+	Arabic               Tag = Tag(compact.Arabic)
+	ModernStandardArabic Tag = Tag(compact.ModernStandardArabic)
+	Azerbaijani          Tag = Tag(compact.Azerbaijani)
+	Bulgarian            Tag = Tag(compact.Bulgarian)
+	Bengali              Tag = Tag(compact.Bengali)
+	Catalan              Tag = Tag(compact.Catalan)
+	Czech                Tag = Tag(compact.Czech)
+	Danish               Tag = Tag(compact.Danish)
+	German               Tag = Tag(compact.German)
+	Greek                Tag = Tag(compact.Greek)
+	English              Tag = Tag(compact.English)
+	AmericanEnglish      Tag = Tag(compact.AmericanEnglish)
+	BritishEnglish       Tag = Tag(compact.BritishEnglish)
+	Spanish              Tag = Tag(compact.Spanish)
+	EuropeanSpanish      Tag = Tag(compact.EuropeanSpanish)
+	LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish)
+	Estonian             Tag = Tag(compact.Estonian)
+	Persian              Tag = Tag(compact.Persian)
+	Finnish              Tag = Tag(compact.Finnish)
+	Filipino             Tag = Tag(compact.Filipino)
+	French               Tag = Tag(compact.French)
+	CanadianFrench       Tag = Tag(compact.CanadianFrench)
+	Gujarati             Tag = Tag(compact.Gujarati)
+	Hebrew               Tag = Tag(compact.Hebrew)
+	Hindi                Tag = Tag(compact.Hindi)
+	Croatian             Tag = Tag(compact.Croatian)
+	Hungarian            Tag = Tag(compact.Hungarian)
+	Armenian             Tag = Tag(compact.Armenian)
+	Indonesian           Tag = Tag(compact.Indonesian)
+	Icelandic            Tag = Tag(compact.Icelandic)
+	Italian              Tag = Tag(compact.Italian)
+	Japanese             Tag = Tag(compact.Japanese)
+	Georgian             Tag = Tag(compact.Georgian)
+	Kazakh               Tag = Tag(compact.Kazakh)
+	Khmer                Tag = Tag(compact.Khmer)
+	Kannada              Tag = Tag(compact.Kannada)
+	Korean               Tag = Tag(compact.Korean)
+	Kirghiz              Tag = Tag(compact.Kirghiz)
+	Lao                  Tag = Tag(compact.Lao)
+	Lithuanian           Tag = Tag(compact.Lithuanian)
+	Latvian              Tag = Tag(compact.Latvian)
+	Macedonian           Tag = Tag(compact.Macedonian)
+	Malayalam            Tag = Tag(compact.Malayalam)
+	Mongolian            Tag = Tag(compact.Mongolian)
+	Marathi              Tag = Tag(compact.Marathi)
+	Malay                Tag = Tag(compact.Malay)
+	Burmese              Tag = Tag(compact.Burmese)
+	Nepali               Tag = Tag(compact.Nepali)
+	Dutch                Tag = Tag(compact.Dutch)
+	Norwegian            Tag = Tag(compact.Norwegian)
+	Punjabi              Tag = Tag(compact.Punjabi)
+	Polish               Tag = Tag(compact.Polish)
+	Portuguese           Tag = Tag(compact.Portuguese)
+	BrazilianPortuguese  Tag = Tag(compact.BrazilianPortuguese)
+	EuropeanPortuguese   Tag = Tag(compact.EuropeanPortuguese)
+	Romanian             Tag = Tag(compact.Romanian)
+	Russian              Tag = Tag(compact.Russian)
+	Sinhala              Tag = Tag(compact.Sinhala)
+	Slovak               Tag = Tag(compact.Slovak)
+	Slovenian            Tag = Tag(compact.Slovenian)
+	Albanian             Tag = Tag(compact.Albanian)
+	Serbian              Tag = Tag(compact.Serbian)
+	SerbianLatin         Tag = Tag(compact.SerbianLatin)
+	Swedish              Tag = Tag(compact.Swedish)
+	Swahili              Tag = Tag(compact.Swahili)
+	Tamil                Tag = Tag(compact.Tamil)
+	Telugu               Tag = Tag(compact.Telugu)
+	Thai                 Tag = Tag(compact.Thai)
+	Turkish              Tag = Tag(compact.Turkish)
+	Ukrainian            Tag = Tag(compact.Ukrainian)
+	Urdu                 Tag = Tag(compact.Urdu)
+	Uzbek                Tag = Tag(compact.Uzbek)
+	Vietnamese           Tag = Tag(compact.Vietnamese)
+	Chinese              Tag = Tag(compact.Chinese)
+	SimplifiedChinese    Tag = Tag(compact.SimplifiedChinese)
+	TraditionalChinese   Tag = Tag(compact.TraditionalChinese)
+	Zulu                 Tag = Tag(compact.Zulu)
 )