summaryrefslogtreecommitdiff
path: root/vendor/golang.org/x/text/language
diff options
context:
space:
mode:
Diffstat (limited to 'vendor/golang.org/x/text/language')
-rw-r--r--vendor/golang.org/x/text/language/common.go16
-rw-r--r--vendor/golang.org/x/text/language/coverage.go34
-rw-r--r--vendor/golang.org/x/text/language/doc.go102
-rw-r--r--vendor/golang.org/x/text/language/index.go767
-rw-r--r--vendor/golang.org/x/text/language/language.go802
-rw-r--r--vendor/golang.org/x/text/language/lookup.go396
-rw-r--r--vendor/golang.org/x/text/language/match.go724
-rw-r--r--vendor/golang.org/x/text/language/parse.go737
-rw-r--r--vendor/golang.org/x/text/language/tables.go3771
-rw-r--r--vendor/golang.org/x/text/language/tags.go160
10 files changed, 1032 insertions, 6477 deletions
diff --git a/vendor/golang.org/x/text/language/common.go b/vendor/golang.org/x/text/language/common.go
deleted file mode 100644
index a255bb0a5..000000000
--- a/vendor/golang.org/x/text/language/common.go
+++ /dev/null
@@ -1,16 +0,0 @@
-// This file was generated by go generate; DO NOT EDIT
-
-package language
-
-// This file contains code common to the maketables.go and the package code.
-
-// langAliasType is the type of an alias in langAliasMap.
-type langAliasType int8
-
-const (
- langDeprecated langAliasType = iota
- langMacro
- langLegacy
-
- langAliasTypeUnknown langAliasType = -1
-)
diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go
index 101fd23c1..a24fd1a4d 100644
--- a/vendor/golang.org/x/text/language/coverage.go
+++ b/vendor/golang.org/x/text/language/coverage.go
@@ -7,6 +7,8 @@ package language
import (
"fmt"
"sort"
+
+ "golang.org/x/text/internal/language"
)
// The Coverage interface is used to define the level of coverage of an
@@ -44,9 +46,9 @@ type allSubtags struct{}
// consecutive range, it simply returns a slice of numbers in increasing order.
// The "undefined" region is not returned.
func (s allSubtags) Regions() []Region {
- reg := make([]Region, numRegions)
+ reg := make([]Region, language.NumRegions)
for i := range reg {
- reg[i] = Region{regionID(i + 1)}
+ reg[i] = Region{language.Region(i + 1)}
}
return reg
}
@@ -55,9 +57,9 @@ func (s allSubtags) Regions() []Region {
// consecutive range, it simply returns a slice of numbers in increasing order.
// The "undefined" script is not returned.
func (s allSubtags) Scripts() []Script {
- scr := make([]Script, numScripts)
+ scr := make([]Script, language.NumScripts)
for i := range scr {
- scr[i] = Script{scriptID(i + 1)}
+ scr[i] = Script{language.Script(i + 1)}
}
return scr
}
@@ -65,22 +67,10 @@ func (s allSubtags) Scripts() []Script {
// BaseLanguages returns the list of all supported base languages. It generates
// the list by traversing the internal structures.
func (s allSubtags) BaseLanguages() []Base {
- base := make([]Base, 0, numLanguages)
- for i := 0; i < langNoIndexOffset; i++ {
- // We included "und" already for the value 0.
- if i != nonCanonicalUnd {
- base = append(base, Base{langID(i)})
- }
- }
- i := langNoIndexOffset
- for _, v := range langNoIndex {
- for k := 0; k < 8; k++ {
- if v&1 == 1 {
- base = append(base, Base{langID(i)})
- }
- v >>= 1
- i++
- }
+ bs := language.BaseLanguages()
+ base := make([]Base, len(bs))
+ for i, b := range bs {
+ base[i] = Base{b}
}
return base
}
@@ -90,7 +80,7 @@ func (s allSubtags) Tags() []Tag {
return nil
}
-// coverage is used used by NewCoverage which is used as a convenient way for
+// coverage is used by NewCoverage which is used as a convenient way for
// creating Coverage implementations for partially defined data. Very often a
// package will only need to define a subset of slices. coverage provides a
// convenient way to do this. Moreover, packages using NewCoverage, instead of
@@ -134,7 +124,7 @@ func (s *coverage) BaseLanguages() []Base {
}
a := make([]Base, len(tags))
for i, t := range tags {
- a[i] = Base{langID(t.lang)}
+ a[i] = Base{language.Language(t.lang())}
}
sort.Sort(bases(a))
k := 0
diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go
new file mode 100644
index 000000000..8afecd50e
--- /dev/null
+++ b/vendor/golang.org/x/text/language/doc.go
@@ -0,0 +1,102 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package language implements BCP 47 language tags and related functionality.
+//
+// The most important function of package language is to match a list of
+// user-preferred languages to a list of supported languages.
+// It alleviates the developer of dealing with the complexity of this process
+// and provides the user with the best experience
+// (see https://blog.golang.org/matchlang).
+//
+//
+// Matching preferred against supported languages
+//
+// A Matcher for an application that supports English, Australian English,
+// Danish, and standard Mandarin can be created as follows:
+//
+// var matcher = language.NewMatcher([]language.Tag{
+// language.English, // The first language is used as fallback.
+// language.MustParse("en-AU"),
+// language.Danish,
+// language.Chinese,
+// })
+//
+// This list of supported languages is typically implied by the languages for
+// which there exists translations of the user interface.
+//
+// User-preferred languages usually come as a comma-separated list of BCP 47
+// language tags.
+// The MatchString finds best matches for such strings:
+//
+// handler(w http.ResponseWriter, r *http.Request) {
+// lang, _ := r.Cookie("lang")
+// accept := r.Header.Get("Accept-Language")
+// tag, _ := language.MatchStrings(matcher, lang.String(), accept)
+//
+// // tag should now be used for the initialization of any
+// // locale-specific service.
+// }
+//
+// The Matcher's Match method can be used to match Tags directly.
+//
+// Matchers are aware of the intricacies of equivalence between languages, such
+// as deprecated subtags, legacy tags, macro languages, mutual
+// intelligibility between scripts and languages, and transparently passing
+// BCP 47 user configuration.
+// For instance, it will know that a reader of Bokmål Danish can read Norwegian
+// and will know that Cantonese ("yue") is a good match for "zh-HK".
+//
+//
+// Using match results
+//
+// To guarantee a consistent user experience to the user it is important to
+// use the same language tag for the selection of any locale-specific services.
+// For example, it is utterly confusing to substitute spelled-out numbers
+// or dates in one language in text of another language.
+// More subtly confusing is using the wrong sorting order or casing
+// algorithm for a certain language.
+//
+// All the packages in x/text that provide locale-specific services
+// (e.g. collate, cases) should be initialized with the tag that was
+// obtained at the start of an interaction with the user.
+//
+// Note that Tag that is returned by Match and MatchString may differ from any
+// of the supported languages, as it may contain carried over settings from
+// the user tags.
+// This may be inconvenient when your application has some additional
+// locale-specific data for your supported languages.
+// Match and MatchString both return the index of the matched supported tag
+// to simplify associating such data with the matched tag.
+//
+//
+// Canonicalization
+//
+// If one uses the Matcher to compare languages one does not need to
+// worry about canonicalization.
+//
+// The meaning of a Tag varies per application. The language package
+// therefore delays canonicalization and preserves information as much
+// as possible. The Matcher, however, will always take into account that
+// two different tags may represent the same language.
+//
+// By default, only legacy and deprecated tags are converted into their
+// canonical equivalent. All other information is preserved. This approach makes
+// the confidence scores more accurate and allows matchers to distinguish
+// between variants that are otherwise lost.
+//
+// As a consequence, two tags that should be treated as identical according to
+// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The
+// Matcher handles such distinctions, though, and is aware of the
+// equivalence relations. The CanonType type can be used to alter the
+// canonicalization form.
+//
+// References
+//
+// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47
+//
+package language // import "golang.org/x/text/language"
+
+// TODO: explanation on how to match languages for your own locale-specific
+// service.
diff --git a/vendor/golang.org/x/text/language/index.go b/vendor/golang.org/x/text/language/index.go
deleted file mode 100644
index 50c752186..000000000
--- a/vendor/golang.org/x/text/language/index.go
+++ /dev/null
@@ -1,767 +0,0 @@
-// This file was generated by go generate; DO NOT EDIT
-
-package language
-
-// NumCompactTags is the number of common tags. The maximum tag is
-// NumCompactTags-1.
-const NumCompactTags = 752
-
-var specialTags = []Tag{ // 2 elements
- 0: {lang: 0xd5, region: 0x6d, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"},
- 1: {lang: 0x134, region: 0x134, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"},
-} // Size: 72 bytes
-
-var coreTags = map[uint32]uint16{
- 0x0: 0, // und
- 0x01500000: 3, // af
- 0x015000d1: 4, // af-NA
- 0x01500160: 5, // af-ZA
- 0x01b00000: 6, // agq
- 0x01b00051: 7, // agq-CM
- 0x02000000: 8, // ak
- 0x0200007f: 9, // ak-GH
- 0x02600000: 10, // am
- 0x0260006e: 11, // am-ET
- 0x03900000: 12, // ar
- 0x03900001: 13, // ar-001
- 0x03900022: 14, // ar-AE
- 0x03900038: 15, // ar-BH
- 0x03900061: 16, // ar-DJ
- 0x03900066: 17, // ar-DZ
- 0x0390006a: 18, // ar-EG
- 0x0390006b: 19, // ar-EH
- 0x0390006c: 20, // ar-ER
- 0x03900096: 21, // ar-IL
- 0x0390009a: 22, // ar-IQ
- 0x039000a0: 23, // ar-JO
- 0x039000a7: 24, // ar-KM
- 0x039000ab: 25, // ar-KW
- 0x039000af: 26, // ar-LB
- 0x039000b8: 27, // ar-LY
- 0x039000b9: 28, // ar-MA
- 0x039000c8: 29, // ar-MR
- 0x039000e0: 30, // ar-OM
- 0x039000ec: 31, // ar-PS
- 0x039000f2: 32, // ar-QA
- 0x03900107: 33, // ar-SA
- 0x0390010a: 34, // ar-SD
- 0x03900114: 35, // ar-SO
- 0x03900116: 36, // ar-SS
- 0x0390011b: 37, // ar-SY
- 0x0390011f: 38, // ar-TD
- 0x03900127: 39, // ar-TN
- 0x0390015d: 40, // ar-YE
- 0x03f00000: 41, // ars
- 0x04200000: 42, // as
- 0x04200098: 43, // as-IN
- 0x04300000: 44, // asa
- 0x0430012e: 45, // asa-TZ
- 0x04700000: 46, // ast
- 0x0470006d: 47, // ast-ES
- 0x05700000: 48, // az
- 0x0571e000: 49, // az-Cyrl
- 0x0571e031: 50, // az-Cyrl-AZ
- 0x05752000: 51, // az-Latn
- 0x05752031: 52, // az-Latn-AZ
- 0x05d00000: 53, // bas
- 0x05d00051: 54, // bas-CM
- 0x07000000: 55, // be
- 0x07000046: 56, // be-BY
- 0x07400000: 57, // bem
- 0x07400161: 58, // bem-ZM
- 0x07800000: 59, // bez
- 0x0780012e: 60, // bez-TZ
- 0x07d00000: 61, // bg
- 0x07d00037: 62, // bg-BG
- 0x08100000: 63, // bh
- 0x09e00000: 64, // bm
- 0x09e000c2: 65, // bm-ML
- 0x0a300000: 66, // bn
- 0x0a300034: 67, // bn-BD
- 0x0a300098: 68, // bn-IN
- 0x0a700000: 69, // bo
- 0x0a700052: 70, // bo-CN
- 0x0a700098: 71, // bo-IN
- 0x0b000000: 72, // br
- 0x0b000077: 73, // br-FR
- 0x0b300000: 74, // brx
- 0x0b300098: 75, // brx-IN
- 0x0b500000: 76, // bs
- 0x0b51e000: 77, // bs-Cyrl
- 0x0b51e032: 78, // bs-Cyrl-BA
- 0x0b552000: 79, // bs-Latn
- 0x0b552032: 80, // bs-Latn-BA
- 0x0d500000: 81, // ca
- 0x0d500021: 82, // ca-AD
- 0x0d50006d: 83, // ca-ES
- 0x0d500077: 84, // ca-FR
- 0x0d50009d: 85, // ca-IT
- 0x0da00000: 86, // ce
- 0x0da00105: 87, // ce-RU
- 0x0dd00000: 88, // cgg
- 0x0dd00130: 89, // cgg-UG
- 0x0e300000: 90, // chr
- 0x0e300134: 91, // chr-US
- 0x0e700000: 92, // ckb
- 0x0e70009a: 93, // ckb-IQ
- 0x0e70009b: 94, // ckb-IR
- 0x0f600000: 95, // cs
- 0x0f60005d: 96, // cs-CZ
- 0x0fa00000: 97, // cu
- 0x0fa00105: 98, // cu-RU
- 0x0fc00000: 99, // cy
- 0x0fc0007a: 100, // cy-GB
- 0x0fd00000: 101, // da
- 0x0fd00062: 102, // da-DK
- 0x0fd00081: 103, // da-GL
- 0x10400000: 104, // dav
- 0x104000a3: 105, // dav-KE
- 0x10900000: 106, // de
- 0x1090002d: 107, // de-AT
- 0x10900035: 108, // de-BE
- 0x1090004d: 109, // de-CH
- 0x1090005f: 110, // de-DE
- 0x1090009d: 111, // de-IT
- 0x109000b1: 112, // de-LI
- 0x109000b6: 113, // de-LU
- 0x11300000: 114, // dje
- 0x113000d3: 115, // dje-NE
- 0x11b00000: 116, // dsb
- 0x11b0005f: 117, // dsb-DE
- 0x12000000: 118, // dua
- 0x12000051: 119, // dua-CM
- 0x12400000: 120, // dv
- 0x12700000: 121, // dyo
- 0x12700113: 122, // dyo-SN
- 0x12900000: 123, // dz
- 0x12900042: 124, // dz-BT
- 0x12b00000: 125, // ebu
- 0x12b000a3: 126, // ebu-KE
- 0x12c00000: 127, // ee
- 0x12c0007f: 128, // ee-GH
- 0x12c00121: 129, // ee-TG
- 0x13100000: 130, // el
- 0x1310005c: 131, // el-CY
- 0x13100086: 132, // el-GR
- 0x13400000: 133, // en
- 0x13400001: 134, // en-001
- 0x1340001a: 135, // en-150
- 0x13400024: 136, // en-AG
- 0x13400025: 137, // en-AI
- 0x1340002c: 138, // en-AS
- 0x1340002d: 139, // en-AT
- 0x1340002e: 140, // en-AU
- 0x13400033: 141, // en-BB
- 0x13400035: 142, // en-BE
- 0x13400039: 143, // en-BI
- 0x1340003c: 144, // en-BM
- 0x13400041: 145, // en-BS
- 0x13400045: 146, // en-BW
- 0x13400047: 147, // en-BZ
- 0x13400048: 148, // en-CA
- 0x13400049: 149, // en-CC
- 0x1340004d: 150, // en-CH
- 0x1340004f: 151, // en-CK
- 0x13400051: 152, // en-CM
- 0x1340005b: 153, // en-CX
- 0x1340005c: 154, // en-CY
- 0x1340005f: 155, // en-DE
- 0x13400060: 156, // en-DG
- 0x13400062: 157, // en-DK
- 0x13400063: 158, // en-DM
- 0x1340006c: 159, // en-ER
- 0x13400071: 160, // en-FI
- 0x13400072: 161, // en-FJ
- 0x13400073: 162, // en-FK
- 0x13400074: 163, // en-FM
- 0x1340007a: 164, // en-GB
- 0x1340007b: 165, // en-GD
- 0x1340007e: 166, // en-GG
- 0x1340007f: 167, // en-GH
- 0x13400080: 168, // en-GI
- 0x13400082: 169, // en-GM
- 0x13400089: 170, // en-GU
- 0x1340008b: 171, // en-GY
- 0x1340008c: 172, // en-HK
- 0x13400095: 173, // en-IE
- 0x13400096: 174, // en-IL
- 0x13400097: 175, // en-IM
- 0x13400098: 176, // en-IN
- 0x13400099: 177, // en-IO
- 0x1340009e: 178, // en-JE
- 0x1340009f: 179, // en-JM
- 0x134000a3: 180, // en-KE
- 0x134000a6: 181, // en-KI
- 0x134000a8: 182, // en-KN
- 0x134000ac: 183, // en-KY
- 0x134000b0: 184, // en-LC
- 0x134000b3: 185, // en-LR
- 0x134000b4: 186, // en-LS
- 0x134000be: 187, // en-MG
- 0x134000bf: 188, // en-MH
- 0x134000c5: 189, // en-MO
- 0x134000c6: 190, // en-MP
- 0x134000c9: 191, // en-MS
- 0x134000ca: 192, // en-MT
- 0x134000cb: 193, // en-MU
- 0x134000cd: 194, // en-MW
- 0x134000cf: 195, // en-MY
- 0x134000d1: 196, // en-NA
- 0x134000d4: 197, // en-NF
- 0x134000d5: 198, // en-NG
- 0x134000d8: 199, // en-NL
- 0x134000dc: 200, // en-NR
- 0x134000de: 201, // en-NU
- 0x134000df: 202, // en-NZ
- 0x134000e5: 203, // en-PG
- 0x134000e6: 204, // en-PH
- 0x134000e7: 205, // en-PK
- 0x134000ea: 206, // en-PN
- 0x134000eb: 207, // en-PR
- 0x134000ef: 208, // en-PW
- 0x13400106: 209, // en-RW
- 0x13400108: 210, // en-SB
- 0x13400109: 211, // en-SC
- 0x1340010a: 212, // en-SD
- 0x1340010b: 213, // en-SE
- 0x1340010c: 214, // en-SG
- 0x1340010d: 215, // en-SH
- 0x1340010e: 216, // en-SI
- 0x13400111: 217, // en-SL
- 0x13400116: 218, // en-SS
- 0x1340011a: 219, // en-SX
- 0x1340011c: 220, // en-SZ
- 0x1340011e: 221, // en-TC
- 0x13400124: 222, // en-TK
- 0x13400128: 223, // en-TO
- 0x1340012b: 224, // en-TT
- 0x1340012c: 225, // en-TV
- 0x1340012e: 226, // en-TZ
- 0x13400130: 227, // en-UG
- 0x13400132: 228, // en-UM
- 0x13400134: 229, // en-US
- 0x13400138: 230, // en-VC
- 0x1340013b: 231, // en-VG
- 0x1340013c: 232, // en-VI
- 0x1340013e: 233, // en-VU
- 0x13400141: 234, // en-WS
- 0x13400160: 235, // en-ZA
- 0x13400161: 236, // en-ZM
- 0x13400163: 237, // en-ZW
- 0x13700000: 238, // eo
- 0x13700001: 239, // eo-001
- 0x13900000: 240, // es
- 0x1390001e: 241, // es-419
- 0x1390002b: 242, // es-AR
- 0x1390003e: 243, // es-BO
- 0x13900040: 244, // es-BR
- 0x13900050: 245, // es-CL
- 0x13900053: 246, // es-CO
- 0x13900055: 247, // es-CR
- 0x13900058: 248, // es-CU
- 0x13900064: 249, // es-DO
- 0x13900067: 250, // es-EA
- 0x13900068: 251, // es-EC
- 0x1390006d: 252, // es-ES
- 0x13900085: 253, // es-GQ
- 0x13900088: 254, // es-GT
- 0x1390008e: 255, // es-HN
- 0x13900093: 256, // es-IC
- 0x139000ce: 257, // es-MX
- 0x139000d7: 258, // es-NI
- 0x139000e1: 259, // es-PA
- 0x139000e3: 260, // es-PE
- 0x139000e6: 261, // es-PH
- 0x139000eb: 262, // es-PR
- 0x139000f0: 263, // es-PY
- 0x13900119: 264, // es-SV
- 0x13900134: 265, // es-US
- 0x13900135: 266, // es-UY
- 0x1390013a: 267, // es-VE
- 0x13b00000: 268, // et
- 0x13b00069: 269, // et-EE
- 0x14000000: 270, // eu
- 0x1400006d: 271, // eu-ES
- 0x14100000: 272, // ewo
- 0x14100051: 273, // ewo-CM
- 0x14300000: 274, // fa
- 0x14300023: 275, // fa-AF
- 0x1430009b: 276, // fa-IR
- 0x14900000: 277, // ff
- 0x14900051: 278, // ff-CM
- 0x14900083: 279, // ff-GN
- 0x149000c8: 280, // ff-MR
- 0x14900113: 281, // ff-SN
- 0x14c00000: 282, // fi
- 0x14c00071: 283, // fi-FI
- 0x14e00000: 284, // fil
- 0x14e000e6: 285, // fil-PH
- 0x15300000: 286, // fo
- 0x15300062: 287, // fo-DK
- 0x15300075: 288, // fo-FO
- 0x15900000: 289, // fr
- 0x15900035: 290, // fr-BE
- 0x15900036: 291, // fr-BF
- 0x15900039: 292, // fr-BI
- 0x1590003a: 293, // fr-BJ
- 0x1590003b: 294, // fr-BL
- 0x15900048: 295, // fr-CA
- 0x1590004a: 296, // fr-CD
- 0x1590004b: 297, // fr-CF
- 0x1590004c: 298, // fr-CG
- 0x1590004d: 299, // fr-CH
- 0x1590004e: 300, // fr-CI
- 0x15900051: 301, // fr-CM
- 0x15900061: 302, // fr-DJ
- 0x15900066: 303, // fr-DZ
- 0x15900077: 304, // fr-FR
- 0x15900079: 305, // fr-GA
- 0x1590007d: 306, // fr-GF
- 0x15900083: 307, // fr-GN
- 0x15900084: 308, // fr-GP
- 0x15900085: 309, // fr-GQ
- 0x15900090: 310, // fr-HT
- 0x159000a7: 311, // fr-KM
- 0x159000b6: 312, // fr-LU
- 0x159000b9: 313, // fr-MA
- 0x159000ba: 314, // fr-MC
- 0x159000bd: 315, // fr-MF
- 0x159000be: 316, // fr-MG
- 0x159000c2: 317, // fr-ML
- 0x159000c7: 318, // fr-MQ
- 0x159000c8: 319, // fr-MR
- 0x159000cb: 320, // fr-MU
- 0x159000d2: 321, // fr-NC
- 0x159000d3: 322, // fr-NE
- 0x159000e4: 323, // fr-PF
- 0x159000e9: 324, // fr-PM
- 0x15900101: 325, // fr-RE
- 0x15900106: 326, // fr-RW
- 0x15900109: 327, // fr-SC
- 0x15900113: 328, // fr-SN
- 0x1590011b: 329, // fr-SY
- 0x1590011f: 330, // fr-TD
- 0x15900121: 331, // fr-TG
- 0x15900127: 332, // fr-TN
- 0x1590013e: 333, // fr-VU
- 0x1590013f: 334, // fr-WF
- 0x1590015e: 335, // fr-YT
- 0x16400000: 336, // fur
- 0x1640009d: 337, // fur-IT
- 0x16800000: 338, // fy
- 0x168000d8: 339, // fy-NL
- 0x16900000: 340, // ga
- 0x16900095: 341, // ga-IE
- 0x17800000: 342, // gd
- 0x1780007a: 343, // gd-GB
- 0x18a00000: 344, // gl
- 0x18a0006d: 345, // gl-ES
- 0x19c00000: 346, // gsw
- 0x19c0004d: 347, // gsw-CH
- 0x19c00077: 348, // gsw-FR
- 0x19c000b1: 349, // gsw-LI
- 0x19d00000: 350, // gu
- 0x19d00098: 351, // gu-IN
- 0x1a200000: 352, // guw
- 0x1a400000: 353, // guz
- 0x1a4000a3: 354, // guz-KE
- 0x1a500000: 355, // gv
- 0x1a500097: 356, // gv-IM
- 0x1ad00000: 357, // ha
- 0x1ad0007f: 358, // ha-GH
- 0x1ad000d3: 359, // ha-NE
- 0x1ad000d5: 360, // ha-NG
- 0x1b100000: 361, // haw
- 0x1b100134: 362, // haw-US
- 0x1b500000: 363, // he
- 0x1b500096: 364, // he-IL
- 0x1b700000: 365, // hi
- 0x1b700098: 366, // hi-IN
- 0x1ca00000: 367, // hr
- 0x1ca00032: 368, // hr-BA
- 0x1ca0008f: 369, // hr-HR
- 0x1cb00000: 370, // hsb
- 0x1cb0005f: 371, // hsb-DE
- 0x1ce00000: 372, // hu
- 0x1ce00091: 373, // hu-HU
- 0x1d000000: 374, // hy
- 0x1d000027: 375, // hy-AM
- 0x1da00000: 376, // id
- 0x1da00094: 377, // id-ID
- 0x1df00000: 378, // ig
- 0x1df000d5: 379, // ig-NG
- 0x1e200000: 380, // ii
- 0x1e200052: 381, // ii-CN
- 0x1f000000: 382, // is
- 0x1f00009c: 383, // is-IS
- 0x1f100000: 384, // it
- 0x1f10004d: 385, // it-CH
- 0x1f10009d: 386, // it-IT
- 0x1f100112: 387, // it-SM
- 0x1f200000: 388, // iu
- 0x1f800000: 389, // ja
- 0x1f8000a1: 390, // ja-JP
- 0x1fb00000: 391, // jbo
- 0x1ff00000: 392, // jgo
- 0x1ff00051: 393, // jgo-CM
- 0x20200000: 394, // jmc
- 0x2020012e: 395, // jmc-TZ
- 0x20600000: 396, // jv
- 0x20800000: 397, // ka
- 0x2080007c: 398, // ka-GE
- 0x20a00000: 399, // kab
- 0x20a00066: 400, // kab-DZ
- 0x20e00000: 401, // kaj
- 0x20f00000: 402, // kam
- 0x20f000a3: 403, // kam-KE
- 0x21700000: 404, // kcg
- 0x21b00000: 405, // kde
- 0x21b0012e: 406, // kde-TZ
- 0x21f00000: 407, // kea
- 0x21f00059: 408, // kea-CV
- 0x22c00000: 409, // khq
- 0x22c000c2: 410, // khq-ML
- 0x23100000: 411, // ki
- 0x231000a3: 412, // ki-KE
- 0x23a00000: 413, // kk
- 0x23a000ad: 414, // kk-KZ
- 0x23c00000: 415, // kkj
- 0x23c00051: 416, // kkj-CM
- 0x23d00000: 417, // kl
- 0x23d00081: 418, // kl-GL
- 0x23e00000: 419, // kln
- 0x23e000a3: 420, // kln-KE
- 0x24200000: 421, // km
- 0x242000a5: 422, // km-KH
- 0x24900000: 423, // kn
- 0x24900098: 424, // kn-IN
- 0x24b00000: 425, // ko
- 0x24b000a9: 426, // ko-KP
- 0x24b000aa: 427, // ko-KR
- 0x24d00000: 428, // kok
- 0x24d00098: 429, // kok-IN
- 0x26100000: 430, // ks
- 0x26100098: 431, // ks-IN
- 0x26200000: 432, // ksb
- 0x2620012e: 433, // ksb-TZ
- 0x26400000: 434, // ksf
- 0x26400051: 435, // ksf-CM
- 0x26500000: 436, // ksh
- 0x2650005f: 437, // ksh-DE
- 0x26b00000: 438, // ku
- 0x27800000: 439, // kw
- 0x2780007a: 440, // kw-GB
- 0x28100000: 441, // ky
- 0x281000a4: 442, // ky-KG
- 0x28800000: 443, // lag
- 0x2880012e: 444, // lag-TZ
- 0x28c00000: 445, // lb
- 0x28c000b6: 446, // lb-LU
- 0x29a00000: 447, // lg
- 0x29a00130: 448, // lg-UG
- 0x2a600000: 449, // lkt
- 0x2a600134: 450, // lkt-US
- 0x2ac00000: 451, // ln
- 0x2ac00029: 452, // ln-AO
- 0x2ac0004a: 453, // ln-CD
- 0x2ac0004b: 454, // ln-CF
- 0x2ac0004c: 455, // ln-CG
- 0x2af00000: 456, // lo
- 0x2af000ae: 457, // lo-LA
- 0x2b600000: 458, // lrc
- 0x2b60009a: 459, // lrc-IQ
- 0x2b60009b: 460, // lrc-IR
- 0x2b700000: 461, // lt
- 0x2b7000b5: 462, // lt-LT
- 0x2b900000: 463, // lu
- 0x2b90004a: 464, // lu-CD
- 0x2bb00000: 465, // luo
- 0x2bb000a3: 466, // luo-KE
- 0x2bc00000: 467, // luy
- 0x2bc000a3: 468, // luy-KE
- 0x2be00000: 469, // lv
- 0x2be000b7: 470, // lv-LV
- 0x2c800000: 471, // mas
- 0x2c8000a3: 472, // mas-KE
- 0x2c80012e: 473, // mas-TZ
- 0x2e000000: 474, // mer
- 0x2e0000a3: 475, // mer-KE
- 0x2e400000: 476, // mfe
- 0x2e4000cb: 477, // mfe-MU
- 0x2e800000: 478, // mg
- 0x2e8000be: 479, // mg-MG
- 0x2e900000: 480, // mgh
- 0x2e9000d0: 481, // mgh-MZ
- 0x2eb00000: 482, // mgo
- 0x2eb00051: 483, // mgo-CM
- 0x2f600000: 484, // mk
- 0x2f6000c1: 485, // mk-MK
- 0x2fb00000: 486, // ml
- 0x2fb00098: 487, // ml-IN
- 0x30200000: 488, // mn
- 0x302000c4: 489, // mn-MN
- 0x31200000: 490, // mr
- 0x31200098: 491, // mr-IN
- 0x31600000: 492, // ms
- 0x3160003d: 493, // ms-BN
- 0x316000cf: 494, // ms-MY
- 0x3160010c: 495, // ms-SG
- 0x31700000: 496, // mt
- 0x317000ca: 497, // mt-MT
- 0x31c00000: 498, // mua
- 0x31c00051: 499, // mua-CM
- 0x32800000: 500, // my
- 0x328000c3: 501, // my-MM
- 0x33100000: 502, // mzn
- 0x3310009b: 503, // mzn-IR
- 0x33800000: 504, // nah
- 0x33c00000: 505, // naq
- 0x33c000d1: 506, // naq-NA
- 0x33e00000: 507, // nb
- 0x33e000d9: 508, // nb-NO
- 0x33e0010f: 509, // nb-SJ
- 0x34500000: 510, // nd
- 0x34500163: 511, // nd-ZW
- 0x34700000: 512, // nds
- 0x3470005f: 513, // nds-DE
- 0x347000d8: 514, // nds-NL
- 0x34800000: 515, // ne
- 0x34800098: 516, // ne-IN
- 0x348000da: 517, // ne-NP
- 0x35e00000: 518, // nl
- 0x35e0002f: 519, // nl-AW
- 0x35e00035: 520, // nl-BE
- 0x35e0003f: 521, // nl-BQ
- 0x35e0005a: 522, // nl-CW
- 0x35e000d8: 523, // nl-NL
- 0x35e00115: 524, // nl-SR
- 0x35e0011a: 525, // nl-SX
- 0x35f00000: 526, // nmg
- 0x35f00051: 527, // nmg-CM
- 0x36100000: 528, // nn
- 0x361000d9: 529, // nn-NO
- 0x36300000: 530, // nnh
- 0x36300051: 531, // nnh-CM
- 0x36600000: 532, // no
- 0x36c00000: 533, // nqo
- 0x36d00000: 534, // nr
- 0x37100000: 535, // nso
- 0x37700000: 536, // nus
- 0x37700116: 537, // nus-SS
- 0x37e00000: 538, // ny
- 0x38000000: 539, // nyn
- 0x38000130: 540, // nyn-UG
- 0x38700000: 541, // om
- 0x3870006e: 542, // om-ET
- 0x387000a3: 543, // om-KE
- 0x38c00000: 544, // or
- 0x38c00098: 545, // or-IN
- 0x38f00000: 546, // os
- 0x38f0007c: 547, // os-GE
- 0x38f00105: 548, // os-RU
- 0x39400000: 549, // pa
- 0x39405000: 550, // pa-Arab
- 0x394050e7: 551, // pa-Arab-PK
- 0x3942f000: 552, // pa-Guru
- 0x3942f098: 553, // pa-Guru-IN
- 0x39800000: 554, // pap
- 0x3aa00000: 555, // pl
- 0x3aa000e8: 556, // pl-PL
- 0x3b400000: 557, // prg
- 0x3b400001: 558, // prg-001
- 0x3b500000: 559, // ps
- 0x3b500023: 560, // ps-AF
- 0x3b700000: 561, // pt
- 0x3b700029: 562, // pt-AO
- 0x3b700040: 563, // pt-BR
- 0x3b70004d: 564, // pt-CH
- 0x3b700059: 565, // pt-CV
- 0x3b700085: 566, // pt-GQ
- 0x3b70008a: 567, // pt-GW
- 0x3b7000b6: 568, // pt-LU
- 0x3b7000c5: 569, // pt-MO
- 0x3b7000d0: 570, // pt-MZ
- 0x3b7000ed: 571, // pt-PT
- 0x3b700117: 572, // pt-ST
- 0x3b700125: 573, // pt-TL
- 0x3bb00000: 574, // qu
- 0x3bb0003e: 575, // qu-BO
- 0x3bb00068: 576, // qu-EC
- 0x3bb000e3: 577, // qu-PE
- 0x3cb00000: 578, // rm
- 0x3cb0004d: 579, // rm-CH
- 0x3d000000: 580, // rn
- 0x3d000039: 581, // rn-BI
- 0x3d300000: 582, // ro
- 0x3d3000bb: 583, // ro-MD
- 0x3d300103: 584, // ro-RO
- 0x3d500000: 585, // rof
- 0x3d50012e: 586, // rof-TZ
- 0x3d900000: 587, // ru
- 0x3d900046: 588, // ru-BY
- 0x3d9000a4: 589, // ru-KG
- 0x3d9000ad: 590, // ru-KZ
- 0x3d9000bb: 591, // ru-MD
- 0x3d900105: 592, // ru-RU
- 0x3d90012f: 593, // ru-UA
- 0x3dc00000: 594, // rw
- 0x3dc00106: 595, // rw-RW
- 0x3dd00000: 596, // rwk
- 0x3dd0012e: 597, // rwk-TZ
- 0x3e200000: 598, // sah
- 0x3e200105: 599, // sah-RU
- 0x3e300000: 600, // saq
- 0x3e3000a3: 601, // saq-KE
- 0x3e900000: 602, // sbp
- 0x3e90012e: 603, // sbp-TZ
- 0x3f200000: 604, // sdh
- 0x3f300000: 605, // se
- 0x3f300071: 606, // se-FI
- 0x3f3000d9: 607, // se-NO
- 0x3f30010b: 608, // se-SE
- 0x3f500000: 609, // seh
- 0x3f5000d0: 610, // seh-MZ
- 0x3f700000: 611, // ses
- 0x3f7000c2: 612, // ses-ML
- 0x3f800000: 613, // sg
- 0x3f80004b: 614, // sg-CF
- 0x3fe00000: 615, // shi
- 0x3fe52000: 616, // shi-Latn
- 0x3fe520b9: 617, // shi-Latn-MA
- 0x3fed2000: 618, // shi-Tfng
- 0x3fed20b9: 619, // shi-Tfng-MA
- 0x40200000: 620, // si
- 0x402000b2: 621, // si-LK
- 0x40800000: 622, // sk
- 0x40800110: 623, // sk-SK
- 0x40c00000: 624, // sl
- 0x40c0010e: 625, // sl-SI
- 0x41200000: 626, // sma
- 0x41300000: 627, // smi
- 0x41400000: 628, // smj
- 0x41500000: 629, // smn
- 0x41500071: 630, // smn-FI
- 0x41800000: 631, // sms
- 0x41900000: 632, // sn
- 0x41900163: 633, // sn-ZW
- 0x41f00000: 634, // so
- 0x41f00061: 635, // so-DJ
- 0x41f0006e: 636, // so-ET
- 0x41f000a3: 637, // so-KE
- 0x41f00114: 638, // so-SO
- 0x42700000: 639, // sq
- 0x42700026: 640, // sq-AL
- 0x427000c1: 641, // sq-MK
- 0x4270014c: 642, // sq-XK
- 0x42800000: 643, // sr
- 0x4281e000: 644, // sr-Cyrl
- 0x4281e032: 645, // sr-Cyrl-BA
- 0x4281e0bc: 646, // sr-Cyrl-ME
- 0x4281e104: 647, // sr-Cyrl-RS
- 0x4281e14c: 648, // sr-Cyrl-XK
- 0x42852000: 649, // sr-Latn
- 0x42852032: 650, // sr-Latn-BA
- 0x428520bc: 651, // sr-Latn-ME
- 0x42852104: 652, // sr-Latn-RS
- 0x4285214c: 653, // sr-Latn-XK
- 0x42d00000: 654, // ss
- 0x43000000: 655, // ssy
- 0x43100000: 656, // st
- 0x43a00000: 657, // sv
- 0x43a00030: 658, // sv-AX
- 0x43a00071: 659, // sv-FI
- 0x43a0010b: 660, // sv-SE
- 0x43b00000: 661, // sw
- 0x43b0004a: 662, // sw-CD
- 0x43b000a3: 663, // sw-KE
- 0x43b0012e: 664, // sw-TZ
- 0x43b00130: 665, // sw-UG
- 0x44400000: 666, // syr
- 0x44600000: 667, // ta
- 0x44600098: 668, // ta-IN
- 0x446000b2: 669, // ta-LK
- 0x446000cf: 670, // ta-MY
- 0x4460010c: 671, // ta-SG
- 0x45700000: 672, // te
- 0x45700098: 673, // te-IN
- 0x45a00000: 674, // teo
- 0x45a000a3: 675, // teo-KE
- 0x45a00130: 676, // teo-UG
- 0x46100000: 677, // th
- 0x46100122: 678, // th-TH
- 0x46500000: 679, // ti
- 0x4650006c: 680, // ti-ER
- 0x4650006e: 681, // ti-ET
- 0x46700000: 682, // tig
- 0x46c00000: 683, // tk
- 0x46c00126: 684, // tk-TM
- 0x47600000: 685, // tn
- 0x47800000: 686, // to
- 0x47800128: 687, // to-TO
- 0x48000000: 688, // tr
- 0x4800005c: 689, // tr-CY
- 0x4800012a: 690, // tr-TR
- 0x48400000: 691, // ts
- 0x49a00000: 692, // twq
- 0x49a000d3: 693, // twq-NE
- 0x49f00000: 694, // tzm
- 0x49f000b9: 695, // tzm-MA
- 0x4a200000: 696, // ug
- 0x4a200052: 697, // ug-CN
- 0x4a400000: 698, // uk
- 0x4a40012f: 699, // uk-UA
- 0x4aa00000: 700, // ur
- 0x4aa00098: 701, // ur-IN
- 0x4aa000e7: 702, // ur-PK
- 0x4b200000: 703, // uz
- 0x4b205000: 704, // uz-Arab
- 0x4b205023: 705, // uz-Arab-AF
- 0x4b21e000: 706, // uz-Cyrl
- 0x4b21e136: 707, // uz-Cyrl-UZ
- 0x4b252000: 708, // uz-Latn
- 0x4b252136: 709, // uz-Latn-UZ
- 0x4b400000: 710, // vai
- 0x4b452000: 711, // vai-Latn
- 0x4b4520b3: 712, // vai-Latn-LR
- 0x4b4d9000: 713, // vai-Vaii
- 0x4b4d90b3: 714, // vai-Vaii-LR
- 0x4b600000: 715, // ve
- 0x4b900000: 716, // vi
- 0x4b90013d: 717, // vi-VN
- 0x4bf00000: 718, // vo
- 0x4bf00001: 719, // vo-001
- 0x4c200000: 720, // vun
- 0x4c20012e: 721, // vun-TZ
- 0x4c400000: 722, // wa
- 0x4c500000: 723, // wae
- 0x4c50004d: 724, // wae-CH
- 0x4db00000: 725, // wo
- 0x4e800000: 726, // xh
- 0x4f100000: 727, // xog
- 0x4f100130: 728, // xog-UG
- 0x4ff00000: 729, // yav
- 0x4ff00051: 730, // yav-CM
- 0x50800000: 731, // yi
- 0x50800001: 732, // yi-001
- 0x50e00000: 733, // yo
- 0x50e0003a: 734, // yo-BJ
- 0x50e000d5: 735, // yo-NG
- 0x51500000: 736, // yue
- 0x5150008c: 737, // yue-HK
- 0x51e00000: 738, // zgh
- 0x51e000b9: 739, // zgh-MA
- 0x51f00000: 740, // zh
- 0x51f34000: 741, // zh-Hans
- 0x51f34052: 742, // zh-Hans-CN
- 0x51f3408c: 743, // zh-Hans-HK
- 0x51f340c5: 744, // zh-Hans-MO
- 0x51f3410c: 745, // zh-Hans-SG
- 0x51f35000: 746, // zh-Hant
- 0x51f3508c: 747, // zh-Hant-HK
- 0x51f350c5: 748, // zh-Hant-MO
- 0x51f3512d: 749, // zh-Hant-TW
- 0x52400000: 750, // zu
- 0x52400160: 751, // zu-ZA
-}
-
-// Total table size 4580 bytes (4KiB); checksum: A7F72A2A
diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go
index 5eecceb61..b939c89f1 100644
--- a/vendor/golang.org/x/text/language/language.go
+++ b/vendor/golang.org/x/text/language/language.go
@@ -2,144 +2,42 @@
// Use of this source code is governed by a BSD-style
// license that can be found in the LICENSE file.
-//go:generate go run maketables.go gen_common.go -output tables.go
-//go:generate go run gen_index.go
+//go:generate go run gen.go -output tables.go
-// Package language implements BCP 47 language tags and related functionality.
-//
-// The Tag type, which is used to represent languages, is agnostic to the
-// meaning of its subtags. Tags are not fully canonicalized to preserve
-// information that may be valuable in certain contexts. As a consequence, two
-// different tags may represent identical languages.
-//
-// Initializing language- or locale-specific components usually consists of
-// two steps. The first step is to select a display language based on the
-// preferred languages of the user and the languages supported by an application.
-// The second step is to create the language-specific services based on
-// this selection. Each is discussed in more details below.
-//
-// Matching preferred against supported languages
-//
-// An application may support various languages. This list is typically limited
-// by the languages for which there exists translations of the user interface.
-// Similarly, a user may provide a list of preferred languages which is limited
-// by the languages understood by this user.
-// An application should use a Matcher to find the best supported language based
-// on the user's preferred list.
-// Matchers are aware of the intricacies of equivalence between languages.
-// The default Matcher implementation takes into account things such as
-// deprecated subtags, legacy tags, and mutual intelligibility between scripts
-// and languages.
-//
-// A Matcher for English, Australian English, Danish, and standard Mandarin can
-// be defined as follows:
-//
-// var matcher = language.NewMatcher([]language.Tag{
-// language.English, // The first language is used as fallback.
-// language.MustParse("en-AU"),
-// language.Danish,
-// language.Chinese,
-// })
-//
-// The following code selects the best match for someone speaking Spanish and
-// Norwegian:
-//
-// preferred := []language.Tag{ language.Spanish, language.Norwegian }
-// tag, _, _ := matcher.Match(preferred...)
-//
-// In this case, the best match is Danish, as Danish is sufficiently a match to
-// Norwegian to not have to fall back to the default.
-// See ParseAcceptLanguage on how to handle the Accept-Language HTTP header.
-//
-// Selecting language-specific services
-//
-// One should always use the Tag returned by the Matcher to create an instance
-// of any of the language-specific services provided by the text repository.
-// This prevents the mixing of languages, such as having a different language for
-// messages and display names, as well as improper casing or sorting order for
-// the selected language.
-// Using the returned Tag also allows user-defined settings, such as collation
-// order or numbering system to be transparently passed as options.
-//
-// If you have language-specific data in your application, however, it will in
-// most cases suffice to use the index returned by the matcher to identify
-// the user language.
-// The following loop provides an alternative in case this is not sufficient:
-//
-// supported := map[language.Tag]data{
-// language.English: enData,
-// language.MustParse("en-AU"): enAUData,
-// language.Danish: daData,
-// language.Chinese: zhData,
-// }
-// tag, _, _ := matcher.Match(preferred...)
-// for ; tag != language.Und; tag = tag.Parent() {
-// if v, ok := supported[tag]; ok {
-// return v
-// }
-// }
-// return enData // should not reach here
-//
-// Repeatedly taking the Parent of the tag returned by Match will eventually
-// match one of the tags used to initialize the Matcher.
-//
-// Canonicalization
-//
-// By default, only legacy and deprecated tags are converted into their
-// canonical equivalent. All other information is preserved. This approach makes
-// the confidence scores more accurate and allows matchers to distinguish
-// between variants that are otherwise lost.
-//
-// As a consequence, two tags that should be treated as identical according to
-// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The
-// Matchers will handle such distinctions, though, and are aware of the
-// equivalence relations. The CanonType type can be used to alter the
-// canonicalization form.
-//
-// References
-//
-// BCP 47 - Tags for Identifying Languages
-// http://tools.ietf.org/html/bcp47
-package language // import "golang.org/x/text/language"
+package language
// TODO: Remove above NOTE after:
// - verifying that tables are dropped correctly (most notably matcher tables).
import (
- "errors"
- "fmt"
"strings"
-)
-const (
- // maxCoreSize is the maximum size of a BCP 47 tag without variants and
- // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
- maxCoreSize = 12
-
- // max99thPercentileSize is a somewhat arbitrary buffer size that presumably
- // is large enough to hold at least 99% of the BCP 47 tags.
- max99thPercentileSize = 32
-
- // maxSimpleUExtensionSize is the maximum size of a -u extension with one
- // key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
- maxSimpleUExtensionSize = 14
+ "golang.org/x/text/internal/language"
+ "golang.org/x/text/internal/language/compact"
)
// Tag represents a BCP 47 language tag. It is used to specify an instance of a
// specific language or locale. All language tag values are guaranteed to be
// well-formed.
-type Tag struct {
- lang langID
- region regionID
- script scriptID
- pVariant byte // offset in str, includes preceding '-'
- pExt uint16 // offset of first extension, includes preceding '-'
+type Tag compact.Tag
+
+func makeTag(t language.Tag) (tag Tag) {
+ return Tag(compact.Make(t))
+}
- // str is the string representation of the Tag. It will only be used if the
- // tag has variants or extensions.
- str string
+func (t *Tag) tag() language.Tag {
+ return (*compact.Tag)(t).Tag()
}
+func (t *Tag) isCompact() bool {
+ return (*compact.Tag)(t).IsCompact()
+}
+
+// TODO: improve performance.
+func (t *Tag) lang() language.Language { return t.tag().LangID }
+func (t *Tag) region() language.Region { return t.tag().RegionID }
+func (t *Tag) script() language.Script { return t.tag().ScriptID }
+
// Make is a convenience wrapper for Parse that omits the error.
// In case of an error, a sensible default is returned.
func Make(s string) Tag {
@@ -156,25 +54,13 @@ func (c CanonType) Make(s string) Tag {
// Raw returns the raw base language, script and region, without making an
// attempt to infer their values.
func (t Tag) Raw() (b Base, s Script, r Region) {
- return Base{t.lang}, Script{t.script}, Region{t.region}
-}
-
-// equalTags compares language, script and region subtags only.
-func (t Tag) equalTags(a Tag) bool {
- return t.lang == a.lang && t.script == a.script && t.region == a.region
+ tt := t.tag()
+ return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID}
}
// IsRoot returns true if t is equal to language "und".
func (t Tag) IsRoot() bool {
- if int(t.pVariant) < len(t.str) {
- return false
- }
- return t.equalTags(und)
-}
-
-// private reports whether the Tag consists solely of a private use tag.
-func (t Tag) private() bool {
- return t.str != "" && t.pVariant == 0
+ return compact.Tag(t).IsRoot()
}
// CanonType can be used to enable or disable various types of canonicalization.
@@ -226,73 +112,73 @@ const (
// canonicalize returns the canonicalized equivalent of the tag and
// whether there was any change.
-func (t Tag) canonicalize(c CanonType) (Tag, bool) {
+func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) {
if c == Raw {
return t, false
}
changed := false
if c&SuppressScript != 0 {
- if t.lang < langNoIndexOffset && uint8(t.script) == suppressScript[t.lang] {
- t.script = 0
+ if t.LangID.SuppressScript() == t.ScriptID {
+ t.ScriptID = 0
changed = true
}
}
if c&canonLang != 0 {
for {
- if l, aliasType := normLang(t.lang); l != t.lang {
+ if l, aliasType := t.LangID.Canonicalize(); l != t.LangID {
switch aliasType {
- case langLegacy:
+ case language.Legacy:
if c&Legacy != 0 {
- if t.lang == _sh && t.script == 0 {
- t.script = _Latn
+ if t.LangID == _sh && t.ScriptID == 0 {
+ t.ScriptID = _Latn
}
- t.lang = l
+ t.LangID = l
changed = true
}
- case langMacro:
+ case language.Macro:
if c&Macro != 0 {
// We deviate here from CLDR. The mapping "nb" -> "no"
// qualifies as a typical Macro language mapping. However,
// for legacy reasons, CLDR maps "no", the macro language
// code for Norwegian, to the dominant variant "nb". This
// change is currently under consideration for CLDR as well.
- // See http://unicode.org/cldr/trac/ticket/2698 and also
- // http://unicode.org/cldr/trac/ticket/1790 for some of the
+ // See https://unicode.org/cldr/trac/ticket/2698 and also
+ // https://unicode.org/cldr/trac/ticket/1790 for some of the
// practical implications. TODO: this check could be removed
// if CLDR adopts this change.
- if c&CLDR == 0 || t.lang != _nb {
+ if c&CLDR == 0 || t.LangID != _nb {
changed = true
- t.lang = l
+ t.LangID = l
}
}
- case langDeprecated:
+ case language.Deprecated:
if c&DeprecatedBase != 0 {
- if t.lang == _mo && t.region == 0 {
- t.region = _MD
+ if t.LangID == _mo && t.RegionID == 0 {
+ t.RegionID = _MD
}
- t.lang = l
+ t.LangID = l
changed = true
// Other canonicalization types may still apply.
continue
}
}
- } else if c&Legacy != 0 && t.lang == _no && c&CLDR != 0 {
- t.lang = _nb
+ } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 {
+ t.LangID = _nb
changed = true
}
break
}
}
if c&DeprecatedScript != 0 {
- if t.script == _Qaai {
+ if t.ScriptID == _Qaai {
changed = true
- t.script = _Zinh
+ t.ScriptID = _Zinh
}
}
if c&DeprecatedRegion != 0 {
- if r := normRegion(t.region); r != 0 {
+ if r := t.RegionID.Canonicalize(); r != t.RegionID {
changed = true
- t.region = r
+ t.RegionID = r
}
}
return t, changed
@@ -300,11 +186,20 @@ func (t Tag) canonicalize(c CanonType) (Tag, bool) {
// Canonicalize returns the canonicalized equivalent of the tag.
func (c CanonType) Canonicalize(t Tag) (Tag, error) {
- t, changed := t.canonicalize(c)
- if changed {
- t.remakeString()
+ // First try fast path.
+ if t.isCompact() {
+ if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed {
+ return t, nil
+ }
+ }
+ // It is unlikely that one will canonicalize a tag after matching. So do
+ // a slow but simple approach here.
+ if tag, changed := canonicalize(c, t.tag()); changed {
+ tag.RemakeString()
+ return makeTag(tag), nil
}
return t, nil
+
}
// Confidence indicates the level of certainty for a given return value.
@@ -327,79 +222,38 @@ func (c Confidence) String() string {
return confName[c]
}
-// remakeString is used to update t.str in case lang, script or region changed.
-// It is assumed that pExt and pVariant still point to the start of the
-// respective parts.
-func (t *Tag) remakeString() {
- if t.str == "" {
- return
- }
- extra := t.str[t.pVariant:]
- if t.pVariant > 0 {
- extra = extra[1:]
- }
- if t.equalTags(und) && strings.HasPrefix(extra, "x-") {
- t.str = extra
- t.pVariant = 0
- t.pExt = 0
- return
- }
- var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
- b := buf[:t.genCoreBytes(buf[:])]
- if extra != "" {
- diff := len(b) - int(t.pVariant)
- b = append(b, '-')
- b = append(b, extra...)
- t.pVariant = uint8(int(t.pVariant) + diff)
- t.pExt = uint16(int(t.pExt) + diff)
- } else {
- t.pVariant = uint8(len(b))
- t.pExt = uint16(len(b))
- }
- t.str = string(b)
+// String returns the canonical string representation of the language tag.
+func (t Tag) String() string {
+ return t.tag().String()
}
-// genCoreBytes writes a string for the base languages, script and region tags
-// to the given buffer and returns the number of bytes written. It will never
-// write more than maxCoreSize bytes.
-func (t *Tag) genCoreBytes(buf []byte) int {
- n := t.lang.stringToBuf(buf[:])
- if t.script != 0 {
- n += copy(buf[n:], "-")
- n += copy(buf[n:], t.script.String())
- }
- if t.region != 0 {
- n += copy(buf[n:], "-")
- n += copy(buf[n:], t.region.String())
- }
- return n
+// MarshalText implements encoding.TextMarshaler.
+func (t Tag) MarshalText() (text []byte, err error) {
+ return t.tag().MarshalText()
}
-// String returns the canonical string representation of the language tag.
-func (t Tag) String() string {
- if t.str != "" {
- return t.str
- }
- if t.script == 0 && t.region == 0 {
- return t.lang.String()
- }
- buf := [maxCoreSize]byte{}
- return string(buf[:t.genCoreBytes(buf[:])])
+// UnmarshalText implements encoding.TextUnmarshaler.
+func (t *Tag) UnmarshalText(text []byte) error {
+ var tag language.Tag
+ err := tag.UnmarshalText(text)
+ *t = makeTag(tag)
+ return err
}
// Base returns the base language of the language tag. If the base language is
// unspecified, an attempt will be made to infer it from the context.
// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
func (t Tag) Base() (Base, Confidence) {
- if t.lang != 0 {
- return Base{t.lang}, Exact
+ if b := t.lang(); b != 0 {
+ return Base{b}, Exact
}
+ tt := t.tag()
c := High
- if t.script == 0 && !(Region{t.region}).IsCountry() {
+ if tt.ScriptID == 0 && !tt.RegionID.IsCountry() {
c = Low
}
- if tag, err := addTags(t); err == nil && tag.lang != 0 {
- return Base{tag.lang}, c
+ if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 {
+ return Base{tag.LangID}, c
}
return Base{0}, No
}
@@ -412,35 +266,34 @@ func (t Tag) Base() (Base, Confidence) {
// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined)
// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks
// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts.
-// See http://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for
+// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for
// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified.
// Note that an inferred script is never guaranteed to be the correct one. Latin is
// almost exclusively used for Afrikaans, but Arabic has been used for some texts
// in the past. Also, the script that is commonly used may change over time.
// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
func (t Tag) Script() (Script, Confidence) {
- if t.script != 0 {
- return Script{t.script}, Exact
- }
- sc, c := scriptID(_Zzzz), No
- if t.lang < langNoIndexOffset {
- if scr := scriptID(suppressScript[t.lang]); scr != 0 {
- // Note: it is not always the case that a language with a suppress
- // script value is only written in one script (e.g. kk, ms, pa).
- if t.region == 0 {
- return Script{scriptID(scr)}, High
- }
- sc, c = scr, High
+ if scr := t.script(); scr != 0 {
+ return Script{scr}, Exact
+ }
+ tt := t.tag()
+ sc, c := language.Script(_Zzzz), No
+ if scr := tt.LangID.SuppressScript(); scr != 0 {
+ // Note: it is not always the case that a language with a suppress
+ // script value is only written in one script (e.g. kk, ms, pa).
+ if tt.RegionID == 0 {
+ return Script{scr}, High
}
+ sc, c = scr, High
}
- if tag, err := addTags(t); err == nil {
- if tag.script != sc {
- sc, c = tag.script, Low
+ if tag, err := tt.Maximize(); err == nil {
+ if tag.ScriptID != sc {
+ sc, c = tag.ScriptID, Low
}
} else {
- t, _ = (Deprecated | Macro).Canonicalize(t)
- if tag, err := addTags(t); err == nil && tag.script != sc {
- sc, c = tag.script, Low
+ tt, _ = canonicalize(Deprecated|Macro, tt)
+ if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc {
+ sc, c = tag.ScriptID, Low
}
}
return Script{sc}, c
@@ -450,28 +303,31 @@ func (t Tag) Script() (Script, Confidence) {
// infer a most likely candidate from the context.
// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
func (t Tag) Region() (Region, Confidence) {
- if t.region != 0 {
- return Region{t.region}, Exact
+ if r := t.region(); r != 0 {
+ return Region{r}, Exact
}
- if t, err := addTags(t); err == nil {
- return Region{t.region}, Low // TODO: differentiate between high and low.
+ tt := t.tag()
+ if tt, err := tt.Maximize(); err == nil {
+ return Region{tt.RegionID}, Low // TODO: differentiate between high and low.
}
- t, _ = (Deprecated | Macro).Canonicalize(t)
- if tag, err := addTags(t); err == nil {
- return Region{tag.region}, Low
+ tt, _ = canonicalize(Deprecated|Macro, tt)
+ if tag, err := tt.Maximize(); err == nil {
+ return Region{tag.RegionID}, Low
}
return Region{_ZZ}, No // TODO: return world instead of undetermined?
}
-// Variant returns the variants specified explicitly for this language tag.
+// Variants returns the variants specified explicitly for this language tag.
// or nil if no variant was specified.
func (t Tag) Variants() []Variant {
+ if !compact.Tag(t).MayHaveVariants() {
+ return nil
+ }
v := []Variant{}
- if int(t.pVariant) < int(t.pExt) {
- for x, str := "", t.str[t.pVariant:t.pExt]; str != ""; {
- x, str = nextToken(str)
- v = append(v, Variant{x})
- }
+ x, str := "", t.tag().Variants()
+ for str != "" {
+ x, str = nextToken(str)
+ v = append(v, Variant{x})
}
return v
}
@@ -479,57 +335,13 @@ func (t Tag) Variants() []Variant {
// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
// specific language are substituted with fields from the parent language.
// The parent for a language may change for newer versions of CLDR.
+//
+// Parent returns a tag for a less specific language that is mutually
+// intelligible or Und if there is no such language. This may not be the same as
+// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW"
+// is "zh-Hant", and the parent of "zh-Hant" is "und".
func (t Tag) Parent() Tag {
- if t.str != "" {
- // Strip the variants and extensions.
- t, _ = Raw.Compose(t.Raw())
- if t.region == 0 && t.script != 0 && t.lang != 0 {
- base, _ := addTags(Tag{lang: t.lang})
- if base.script == t.script {
- return Tag{lang: t.lang}
- }
- }
- return t
- }
- if t.lang != 0 {
- if t.region != 0 {
- maxScript := t.script
- if maxScript == 0 {
- max, _ := addTags(t)
- maxScript = max.script
- }
-
- for i := range parents {
- if langID(parents[i].lang) == t.lang && scriptID(parents[i].maxScript) == maxScript {
- for _, r := range parents[i].fromRegion {
- if regionID(r) == t.region {
- return Tag{
- lang: t.lang,
- script: scriptID(parents[i].script),
- region: regionID(parents[i].toRegion),
- }
- }
- }
- }
- }
-
- // Strip the script if it is the default one.
- base, _ := addTags(Tag{lang: t.lang})
- if base.script != maxScript {
- return Tag{lang: t.lang, script: maxScript}
- }
- return Tag{lang: t.lang}
- } else if t.script != 0 {
- // The parent for an base-script pair with a non-default script is
- // "und" instead of the base language.
- base, _ := addTags(Tag{lang: t.lang})
- if base.script != t.script {
- return und
- }
- return Tag{lang: t.lang}
- }
- }
- return und
+ return Tag(compact.Tag(t).Parent())
}
// returns token t and the rest of the string.
@@ -555,17 +367,8 @@ func (e Extension) String() string {
// ParseExtension parses s as an extension and returns it on success.
func ParseExtension(s string) (e Extension, err error) {
- scan := makeScannerString(s)
- var end int
- if n := len(scan.token); n != 1 {
- return Extension{}, errSyntax
- }
- scan.toLower(0, len(scan.b))
- end = parseExtension(&scan)
- if end != len(s) {
- return Extension{}, errSyntax
- }
- return Extension{string(scan.b)}, nil
+ ext, err := language.ParseExtension(s)
+ return Extension{ext}, err
}
// Type returns the one-byte extension type of e. It returns 0 for the zero
@@ -586,22 +389,20 @@ func (e Extension) Tokens() []string {
// false for ok if t does not have the requested extension. The returned
// extension will be invalid in this case.
func (t Tag) Extension(x byte) (ext Extension, ok bool) {
- for i := int(t.pExt); i < len(t.str)-1; {
- var ext string
- i, ext = getExtension(t.str, i)
- if ext[0] == x {
- return Extension{ext}, true
- }
+ if !compact.Tag(t).MayHaveExtensions() {
+ return Extension{}, false
}
- return Extension{}, false
+ e, ok := t.tag().Extension(x)
+ return Extension{e}, ok
}
// Extensions returns all extensions of t.
func (t Tag) Extensions() []Extension {
+ if !compact.Tag(t).MayHaveExtensions() {
+ return nil
+ }
e := []Extension{}
- for i := int(t.pExt); i < len(t.str)-1; {
- var ext string
- i, ext = getExtension(t.str, i)
+ for _, ext := range t.tag().Extensions() {
e = append(e, Extension{ext})
}
return e
@@ -609,259 +410,105 @@ func (t Tag) Extensions() []Extension {
// TypeForKey returns the type associated with the given key, where key and type
// are of the allowed values defined for the Unicode locale extension ('u') in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
// TypeForKey will traverse the inheritance chain to get the correct value.
func (t Tag) TypeForKey(key string) string {
- if start, end, _ := t.findTypeForKey(key); end != start {
- return t.str[start:end]
+ if !compact.Tag(t).MayHaveExtensions() {
+ if key != "rg" && key != "va" {
+ return ""
+ }
}
- return ""
+ return t.tag().TypeForKey(key)
}
-var (
- errPrivateUse = errors.New("cannot set a key on a private use tag")
- errInvalidArguments = errors.New("invalid key or type")
-)
-
// SetTypeForKey returns a new Tag with the key set to type, where key and type
// are of the allowed values defined for the Unicode locale extension ('u') in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
// An empty value removes an existing pair with the same key.
func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
- if t.private() {
- return t, errPrivateUse
- }
- if len(key) != 2 {
- return t, errInvalidArguments
- }
-
- // Remove the setting if value is "".
- if value == "" {
- start, end, _ := t.findTypeForKey(key)
- if start != end {
- // Remove key tag and leading '-'.
- start -= 4
-
- // Remove a possible empty extension.
- if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' {
- start -= 2
- }
- if start == int(t.pVariant) && end == len(t.str) {
- t.str = ""
- t.pVariant, t.pExt = 0, 0
- } else {
- t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
- }
- }
- return t, nil
- }
-
- if len(value) < 3 || len(value) > 8 {
- return t, errInvalidArguments
- }
-
- var (
- buf [maxCoreSize + maxSimpleUExtensionSize]byte
- uStart int // start of the -u extension.
- )
-
- // Generate the tag string if needed.
- if t.str == "" {
- uStart = t.genCoreBytes(buf[:])
- buf[uStart] = '-'
- uStart++
- }
-
- // Create new key-type pair and parse it to verify.
- b := buf[uStart:]
- copy(b, "u-")
- copy(b[2:], key)
- b[4] = '-'
- b = b[:5+copy(b[5:], value)]
- scan := makeScanner(b)
- if parseExtensions(&scan); scan.err != nil {
- return t, scan.err
- }
-
- // Assemble the replacement string.
- if t.str == "" {
- t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
- t.str = string(buf[:uStart+len(b)])
- } else {
- s := t.str
- start, end, hasExt := t.findTypeForKey(key)
- if start == end {
- if hasExt {
- b = b[2:]
- }
- t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:])
- } else {
- t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:])
- }
- }
- return t, nil
+ tt, err := t.tag().SetTypeForKey(key, value)
+ return makeTag(tt), err
}
-// findKeyAndType returns the start and end position for the type corresponding
-// to key or the point at which to insert the key-value pair if the type
-// wasn't found. The hasExt return value reports whether an -u extension was present.
-// Note: the extensions are typically very small and are likely to contain
-// only one key-type pair.
-func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) {
- p := int(t.pExt)
- if len(key) != 2 || p == len(t.str) || p == 0 {
- return p, p, false
- }
- s := t.str
-
- // Find the correct extension.
- for p++; s[p] != 'u'; p++ {
- if s[p] > 'u' {
- p--
- return p, p, false
- }
- if p = nextExtension(s, p); p == len(s) {
- return len(s), len(s), false
- }
- }
- // Proceed to the hyphen following the extension name.
- p++
-
- // curKey is the key currently being processed.
- curKey := ""
-
- // Iterate over keys until we get the end of a section.
- for {
- // p points to the hyphen preceding the current token.
- if p3 := p + 3; s[p3] == '-' {
- // Found a key.
- // Check whether we just processed the key that was requested.
- if curKey == key {
- return start, p, true
- }
- // Set to the next key and continue scanning type tokens.
- curKey = s[p+1 : p3]
- if curKey > key {
- return p, p, true
- }
- // Start of the type token sequence.
- start = p + 4
- // A type is at least 3 characters long.
- p += 7 // 4 + 3
- } else {
- // Attribute or type, which is at least 3 characters long.
- p += 4
- }
- // p points past the third character of a type or attribute.
- max := p + 5 // maximum length of token plus hyphen.
- if len(s) < max {
- max = len(s)
- }
- for ; p < max && s[p] != '-'; p++ {
- }
- // Bail if we have exhausted all tokens or if the next token starts
- // a new extension.
- if p == len(s) || s[p+2] == '-' {
- if curKey == key {
- return start, p, true
- }
- return p, p, true
- }
- }
-}
+// NumCompactTags is the number of compact tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = compact.NumCompactTags
// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags
-// for which data exists in the text repository. The index will change over time
-// and should not be stored in persistent storage. Extensions, except for the
-// 'va' type of the 'u' extension, are ignored. It will return 0, false if no
-// compact tag exists, where 0 is the index for the root language (Und).
-func CompactIndex(t Tag) (index int, ok bool) {
- // TODO: perhaps give more frequent tags a lower index.
- // TODO: we could make the indexes stable. This will excluded some
- // possibilities for optimization, so don't do this quite yet.
- b, s, r := t.Raw()
- if len(t.str) > 0 {
- if strings.HasPrefix(t.str, "x-") {
- // We have no entries for user-defined tags.
- return 0, false
- }
- if uint16(t.pVariant) != t.pExt {
- // There are no tags with variants and an u-va type.
- if t.TypeForKey("va") != "" {
- return 0, false
- }
- t, _ = Raw.Compose(b, s, r, t.Variants())
- } else if _, ok := t.Extension('u'); ok {
- // Strip all but the 'va' entry.
- variant := t.TypeForKey("va")
- t, _ = Raw.Compose(b, s, r)
- t, _ = t.SetTypeForKey("va", variant)
- }
- if len(t.str) > 0 {
- // We have some variants.
- for i, s := range specialTags {
- if s == t {
- return i + 1, true
- }
- }
- return 0, false
- }
- }
- // No variants specified: just compare core components.
- // The key has the form lllssrrr, where l, s, and r are nibbles for
- // respectively the langID, scriptID, and regionID.
- key := uint32(b.langID) << (8 + 12)
- key |= uint32(s.scriptID) << 12
- key |= uint32(r.regionID)
- x, ok := coreTags[key]
- return int(x), ok
+// for which data exists in the text repository.The index will change over time
+// and should not be stored in persistent storage. If t does not match a compact
+// index, exact will be false and the compact index will be returned for the
+// first match after repeatedly taking the Parent of t.
+func CompactIndex(t Tag) (index int, exact bool) {
+ id, exact := compact.LanguageID(compact.Tag(t))
+ return int(id), exact
}
+var root = language.Tag{}
+
// Base is an ISO 639 language code, used for encoding the base language
// of a language tag.
type Base struct {
- langID
+ langID language.Language
}
// ParseBase parses a 2- or 3-letter ISO 639 code.
// It returns a ValueError if s is a well-formed but unknown language identifier
// or another error if another error occurred.
func ParseBase(s string) (Base, error) {
- if n := len(s); n < 2 || 3 < n {
- return Base{}, errSyntax
- }
- var buf [3]byte
- l, err := getLangID(buf[:copy(buf[:], s)])
+ l, err := language.ParseBase(s)
return Base{l}, err
}
+// String returns the BCP 47 representation of the base language.
+func (b Base) String() string {
+ return b.langID.String()
+}
+
+// ISO3 returns the ISO 639-3 language code.
+func (b Base) ISO3() string {
+ return b.langID.ISO3()
+}
+
+// IsPrivateUse reports whether this language code is reserved for private use.
+func (b Base) IsPrivateUse() bool {
+ return b.langID.IsPrivateUse()
+}
+
// Script is a 4-letter ISO 15924 code for representing scripts.
// It is idiomatically represented in title case.
type Script struct {
- scriptID
+ scriptID language.Script
}
// ParseScript parses a 4-letter ISO 15924 code.
// It returns a ValueError if s is a well-formed but unknown script identifier
// or another error if another error occurred.
func ParseScript(s string) (Script, error) {
- if len(s) != 4 {
- return Script{}, errSyntax
- }
- var buf [4]byte
- sc, err := getScriptID(script, buf[:copy(buf[:], s)])
+ sc, err := language.ParseScript(s)
return Script{sc}, err
}
+// String returns the script code in title case.
+// It returns "Zzzz" for an unspecified script.
+func (s Script) String() string {
+ return s.scriptID.String()
+}
+
+// IsPrivateUse reports whether this script code is reserved for private use.
+func (s Script) IsPrivateUse() bool {
+ return s.scriptID.IsPrivateUse()
+}
+
// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions.
type Region struct {
- regionID
+ regionID language.Region
}
// EncodeM49 returns the Region for the given UN M.49 code.
// It returns an error if r is not a valid code.
func EncodeM49(r int) (Region, error) {
- rid, err := getRegionM49(r)
+ rid, err := language.EncodeM49(r)
return Region{rid}, err
}
@@ -869,62 +516,54 @@ func EncodeM49(r int) (Region, error) {
// It returns a ValueError if s is a well-formed but unknown region identifier
// or another error if another error occurred.
func ParseRegion(s string) (Region, error) {
- if n := len(s); n < 2 || 3 < n {
- return Region{}, errSyntax
- }
- var buf [3]byte
- r, err := getRegionID(buf[:copy(buf[:], s)])
+ r, err := language.ParseRegion(s)
return Region{r}, err
}
+// String returns the BCP 47 representation for the region.
+// It returns "ZZ" for an unspecified region.
+func (r Region) String() string {
+ return r.regionID.String()
+}
+
+// ISO3 returns the 3-letter ISO code of r.
+// Note that not all regions have a 3-letter ISO code.
+// In such cases this method returns "ZZZ".
+func (r Region) ISO3() string {
+ return r.regionID.String()
+}
+
+// M49 returns the UN M.49 encoding of r, or 0 if this encoding
+// is not defined for r.
+func (r Region) M49() int {
+ return r.regionID.M49()
+}
+
+// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
+// may include private-use tags that are assigned by CLDR and used in this
+// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
+func (r Region) IsPrivateUse() bool {
+ return r.regionID.IsPrivateUse()
+}
+
// IsCountry returns whether this region is a country or autonomous area. This
// includes non-standard definitions from CLDR.
func (r Region) IsCountry() bool {
- if r.regionID == 0 || r.IsGroup() || r.IsPrivateUse() && r.regionID != _XK {
- return false
- }
- return true
+ return r.regionID.IsCountry()
}
// IsGroup returns whether this region defines a collection of regions. This
// includes non-standard definitions from CLDR.
func (r Region) IsGroup() bool {
- if r.regionID == 0 {
- return false
- }
- return int(regionInclusion[r.regionID]) < len(regionContainment)
+ return r.regionID.IsGroup()
}
// Contains returns whether Region c is contained by Region r. It returns true
// if c == r.
func (r Region) Contains(c Region) bool {
- return r.regionID.contains(c.regionID)
+ return r.regionID.Contains(c.regionID)
}
-func (r regionID) contains(c regionID) bool {
- if r == c {
- return true
- }
- g := regionInclusion[r]
- if g >= nRegionGroups {
- return false
- }
- m := regionContainment[g]
-
- d := regionInclusion[c]
- b := regionInclusionBits[d]
-
- // A contained country may belong to multiple disjoint groups. Matching any
- // of these indicates containment. If the contained region is a group, it
- // must strictly be a subset.
- if d >= nRegionGroups {
- return b&m != 0
- }
- return b&^m == 0
-}
-
-var errNoTLD = errors.New("language: region is not a valid ccTLD")
-
// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
// In all other cases it returns either the region itself or an error.
//
@@ -933,25 +572,15 @@ var errNoTLD = errors.New("language: region is not a valid ccTLD")
// region will already be canonicalized it was obtained from a Tag that was
// obtained using any of the default methods.
func (r Region) TLD() (Region, error) {
- // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
- // difference between ISO 3166-1 and IANA ccTLD.
- if r.regionID == _GB {
- r = Region{_UK}
- }
- if (r.typ() & ccTLD) == 0 {
- return Region{}, errNoTLD
- }
- return r, nil
+ tld, err := r.regionID.TLD()
+ return Region{tld}, err
}
// Canonicalize returns the region or a possible replacement if the region is
// deprecated. It will not return a replacement for deprecated regions that
// are split into multiple regions.
func (r Region) Canonicalize() Region {
- if cr := normRegion(r.regionID); cr != 0 {
- return Region{cr}
- }
- return r
+ return Region{r.regionID.Canonicalize()}
}
// Variant represents a registered variant of a language as defined by BCP 47.
@@ -962,11 +591,8 @@ type Variant struct {
// ParseVariant parses and returns a Variant. An error is returned if s is not
// a valid variant.
func ParseVariant(s string) (Variant, error) {
- s = strings.ToLower(s)
- if _, ok := variantIndex[s]; ok {
- return Variant{s}, nil
- }
- return Variant{}, mkErrInvalid([]byte(s))
+ v, err := language.ParseVariant(s)
+ return Variant{v.String()}, err
}
// String returns the string representation of the variant.
diff --git a/vendor/golang.org/x/text/language/lookup.go b/vendor/golang.org/x/text/language/lookup.go
deleted file mode 100644
index 1d80ac370..000000000
--- a/vendor/golang.org/x/text/language/lookup.go
+++ /dev/null
@@ -1,396 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import (
- "bytes"
- "fmt"
- "sort"
- "strconv"
-
- "golang.org/x/text/internal/tag"
-)
-
-// findIndex tries to find the given tag in idx and returns a standardized error
-// if it could not be found.
-func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
- if !tag.FixCase(form, key) {
- return 0, errSyntax
- }
- i := idx.Index(key)
- if i == -1 {
- return 0, mkErrInvalid(key)
- }
- return i, nil
-}
-
-func searchUint(imap []uint16, key uint16) int {
- return sort.Search(len(imap), func(i int) bool {
- return imap[i] >= key
- })
-}
-
-type langID uint16
-
-// getLangID returns the langID of s if s is a canonical subtag
-// or langUnknown if s is not a canonical subtag.
-func getLangID(s []byte) (langID, error) {
- if len(s) == 2 {
- return getLangISO2(s)
- }
- return getLangISO3(s)
-}
-
-// mapLang returns the mapped langID of id according to mapping m.
-func normLang(id langID) (langID, langAliasType) {
- k := sort.Search(len(langAliasMap), func(i int) bool {
- return langAliasMap[i].from >= uint16(id)
- })
- if k < len(langAliasMap) && langAliasMap[k].from == uint16(id) {
- return langID(langAliasMap[k].to), langAliasTypes[k]
- }
- return id, langAliasTypeUnknown
-}
-
-// getLangISO2 returns the langID for the given 2-letter ISO language code
-// or unknownLang if this does not exist.
-func getLangISO2(s []byte) (langID, error) {
- if !tag.FixCase("zz", s) {
- return 0, errSyntax
- }
- if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
- return langID(i), nil
- }
- return 0, mkErrInvalid(s)
-}
-
-const base = 'z' - 'a' + 1
-
-func strToInt(s []byte) uint {
- v := uint(0)
- for i := 0; i < len(s); i++ {
- v *= base
- v += uint(s[i] - 'a')
- }
- return v
-}
-
-// converts the given integer to the original ASCII string passed to strToInt.
-// len(s) must match the number of characters obtained.
-func intToStr(v uint, s []byte) {
- for i := len(s) - 1; i >= 0; i-- {
- s[i] = byte(v%base) + 'a'
- v /= base
- }
-}
-
-// getLangISO3 returns the langID for the given 3-letter ISO language code
-// or unknownLang if this does not exist.
-func getLangISO3(s []byte) (langID, error) {
- if tag.FixCase("und", s) {
- // first try to match canonical 3-letter entries
- for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
- if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] {
- // We treat "und" as special and always translate it to "unspecified".
- // Note that ZZ and Zzzz are private use and are not treated as
- // unspecified by default.
- id := langID(i)
- if id == nonCanonicalUnd {
- return 0, nil
- }
- return id, nil
- }
- }
- if i := altLangISO3.Index(s); i != -1 {
- return langID(altLangIndex[altLangISO3.Elem(i)[3]]), nil
- }
- n := strToInt(s)
- if langNoIndex[n/8]&(1<<(n%8)) != 0 {
- return langID(n) + langNoIndexOffset, nil
- }
- // Check for non-canonical uses of ISO3.
- for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
- if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
- return langID(i), nil
- }
- }
- return 0, mkErrInvalid(s)
- }
- return 0, errSyntax
-}
-
-// stringToBuf writes the string to b and returns the number of bytes
-// written. cap(b) must be >= 3.
-func (id langID) stringToBuf(b []byte) int {
- if id >= langNoIndexOffset {
- intToStr(uint(id)-langNoIndexOffset, b[:3])
- return 3
- } else if id == 0 {
- return copy(b, "und")
- }
- l := lang[id<<2:]
- if l[3] == 0 {
- return copy(b, l[:3])
- }
- return copy(b, l[:2])
-}
-
-// String returns the BCP 47 representation of the langID.
-// Use b as variable name, instead of id, to ensure the variable
-// used is consistent with that of Base in which this type is embedded.
-func (b langID) String() string {
- if b == 0 {
- return "und"
- } else if b >= langNoIndexOffset {
- b -= langNoIndexOffset
- buf := [3]byte{}
- intToStr(uint(b), buf[:])
- return string(buf[:])
- }
- l := lang.Elem(int(b))
- if l[3] == 0 {
- return l[:3]
- }
- return l[:2]
-}
-
-// ISO3 returns the ISO 639-3 language code.
-func (b langID) ISO3() string {
- if b == 0 || b >= langNoIndexOffset {
- return b.String()
- }
- l := lang.Elem(int(b))
- if l[3] == 0 {
- return l[:3]
- } else if l[2] == 0 {
- return altLangISO3.Elem(int(l[3]))[:3]
- }
- // This allocation will only happen for 3-letter ISO codes
- // that are non-canonical BCP 47 language identifiers.
- return l[0:1] + l[2:4]
-}
-
-// IsPrivateUse reports whether this language code is reserved for private use.
-func (b langID) IsPrivateUse() bool {
- return langPrivateStart <= b && b <= langPrivateEnd
-}
-
-type regionID uint16
-
-// getRegionID returns the region id for s if s is a valid 2-letter region code
-// or unknownRegion.
-func getRegionID(s []byte) (regionID, error) {
- if len(s) == 3 {
- if isAlpha(s[0]) {
- return getRegionISO3(s)
- }
- if i, err := strconv.ParseUint(string(s), 10, 10); err == nil {
- return getRegionM49(int(i))
- }
- }
- return getRegionISO2(s)
-}
-
-// getRegionISO2 returns the regionID for the given 2-letter ISO country code
-// or unknownRegion if this does not exist.
-func getRegionISO2(s []byte) (regionID, error) {
- i, err := findIndex(regionISO, s, "ZZ")
- if err != nil {
- return 0, err
- }
- return regionID(i) + isoRegionOffset, nil
-}
-
-// getRegionISO3 returns the regionID for the given 3-letter ISO country code
-// or unknownRegion if this does not exist.
-func getRegionISO3(s []byte) (regionID, error) {
- if tag.FixCase("ZZZ", s) {
- for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
- if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
- return regionID(i) + isoRegionOffset, nil
- }
- }
- for i := 0; i < len(altRegionISO3); i += 3 {
- if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
- return regionID(altRegionIDs[i/3]), nil
- }
- }
- return 0, mkErrInvalid(s)
- }
- return 0, errSyntax
-}
-
-func getRegionM49(n int) (regionID, error) {
- if 0 < n && n <= 999 {
- const (
- searchBits = 7
- regionBits = 9
- regionMask = 1<<regionBits - 1
- )
- idx := n >> searchBits
- buf := fromM49[m49Index[idx]:m49Index[idx+1]]
- val := uint16(n) << regionBits // we rely on bits shifting out
- i := sort.Search(len(buf), func(i int) bool {
- return buf[i] >= val
- })
- if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
- return regionID(r & regionMask), nil
- }
- }
- var e ValueError
- fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n)
- return 0, e
-}
-
-// normRegion returns a region if r is deprecated or 0 otherwise.
-// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
-// TODO: consider mapping split up regions to new most populous one (like CLDR).
-func normRegion(r regionID) regionID {
- m := regionOldMap
- k := sort.Search(len(m), func(i int) bool {
- return m[i].from >= uint16(r)
- })
- if k < len(m) && m[k].from == uint16(r) {
- return regionID(m[k].to)
- }
- return 0
-}
-
-const (
- iso3166UserAssigned = 1 << iota
- ccTLD
- bcp47Region
-)
-
-func (r regionID) typ() byte {
- return regionTypes[r]
-}
-
-// String returns the BCP 47 representation for the region.
-// It returns "ZZ" for an unspecified region.
-func (r regionID) String() string {
- if r < isoRegionOffset {
- if r == 0 {
- return "ZZ"
- }
- return fmt.Sprintf("%03d", r.M49())
- }
- r -= isoRegionOffset
- return regionISO.Elem(int(r))[:2]
-}
-
-// ISO3 returns the 3-letter ISO code of r.
-// Note that not all regions have a 3-letter ISO code.
-// In such cases this method returns "ZZZ".
-func (r regionID) ISO3() string {
- if r < isoRegionOffset {
- return "ZZZ"
- }
- r -= isoRegionOffset
- reg := regionISO.Elem(int(r))
- switch reg[2] {
- case 0:
- return altRegionISO3[reg[3]:][:3]
- case ' ':
- return "ZZZ"
- }
- return reg[0:1] + reg[2:4]
-}
-
-// M49 returns the UN M.49 encoding of r, or 0 if this encoding
-// is not defined for r.
-func (r regionID) M49() int {
- return int(m49[r])
-}
-
-// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
-// may include private-use tags that are assigned by CLDR and used in this
-// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
-func (r regionID) IsPrivateUse() bool {
- return r.typ()&iso3166UserAssigned != 0
-}
-
-type scriptID uint8
-
-// getScriptID returns the script id for string s. It assumes that s
-// is of the format [A-Z][a-z]{3}.
-func getScriptID(idx tag.Index, s []byte) (scriptID, error) {
- i, err := findIndex(idx, s, "Zzzz")
- return scriptID(i), err
-}
-
-// String returns the script code in title case.
-// It returns "Zzzz" for an unspecified script.
-func (s scriptID) String() string {
- if s == 0 {
- return "Zzzz"
- }
- return script.Elem(int(s))
-}
-
-// IsPrivateUse reports whether this script code is reserved for private use.
-func (s scriptID) IsPrivateUse() bool {
- return _Qaaa <= s && s <= _Qabx
-}
-
-const (
- maxAltTaglen = len("en-US-POSIX")
- maxLen = maxAltTaglen
-)
-
-var (
- // grandfatheredMap holds a mapping from legacy and grandfathered tags to
- // their base language or index to more elaborate tag.
- grandfatheredMap = map[[maxLen]byte]int16{
- [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban
- [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami
- [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn
- [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak
- [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon
- [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux
- [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo
- [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn
- [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao
- [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay
- [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu
- [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok
- [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn
- [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR
- [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL
- [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE
- [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu
- [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka
- [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan
- [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang
-
- // Grandfathered tags with no modern replacement will be converted as
- // follows:
- [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish
- [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed
- [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default
- [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian
- [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo
- [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min
-
- // CLDR-specific tag.
- [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root
- [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX"
- }
-
- altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102}
-
- altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix"
-)
-
-func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) {
- if v, ok := grandfatheredMap[s]; ok {
- if v < 0 {
- return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
- }
- t.lang = langID(v)
- return t, true
- }
- return t, false
-}
diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go
index 8ad950533..f73492134 100644
--- a/vendor/golang.org/x/text/language/match.go
+++ b/vendor/golang.org/x/text/language/match.go
@@ -4,7 +4,45 @@
package language
-import "errors"
+import (
+ "errors"
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// A MatchOption configures a Matcher.
+type MatchOption func(*matcher)
+
+// PreferSameScript will, in the absence of a match, result in the first
+// preferred tag with the same script as a supported tag to match this supported
+// tag. The default is currently true, but this may change in the future.
+func PreferSameScript(preferSame bool) MatchOption {
+ return func(m *matcher) { m.preferSameScript = preferSame }
+}
+
+// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface.
+// There doesn't seem to be too much need for multiple types.
+// Making it a concrete type allows MatchStrings to be a method, which will
+// improve its discoverability.
+
+// MatchStrings parses and matches the given strings until one of them matches
+// the language in the Matcher. A string may be an Accept-Language header as
+// handled by ParseAcceptLanguage. The default language is returned if no
+// other language matched.
+func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) {
+ for _, accept := range lang {
+ desired, _, err := ParseAcceptLanguage(accept)
+ if err != nil {
+ continue
+ }
+ if tag, index, conf := m.Match(desired...); conf != No {
+ return tag, index
+ }
+ }
+ tag, index, _ = m.Match()
+ return
+}
// Matcher is the interface that wraps the Match method.
//
@@ -36,248 +74,76 @@ func Comprehends(speaker, alternative Tag) Confidence {
// matched tag in t, but is augmented with the Unicode extension ('u')of the
// corresponding preferred tag. This allows user locale options to be passed
// transparently.
-func NewMatcher(t []Tag) Matcher {
- return newMatcher(t)
+func NewMatcher(t []Tag, options ...MatchOption) Matcher {
+ return newMatcher(t, options)
}
func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) {
+ var tt language.Tag
match, w, c := m.getBest(want...)
- if match == nil {
- t = m.default_.tag
+ if match != nil {
+ tt, index = match.tag, match.index
} else {
- t, index = match.tag, match.index
- }
- // Copy options from the user-provided tag into the result tag. This is hard
- // to do after the fact, so we do it here.
- // TODO: consider also adding in variants that are compatible with the
- // matched language.
- // TODO: Add back region if it is non-ambiguous? Or create another tag to
- // preserve the region?
- if u, ok := w.Extension('u'); ok {
- t, _ = Raw.Compose(t, u)
- }
- return t, index, c
-}
-
-type scriptRegionFlags uint8
-
-const (
- isList = 1 << iota
- scriptInFrom
- regionInFrom
-)
-
-func (t *Tag) setUndefinedLang(id langID) {
- if t.lang == 0 {
- t.lang = id
- }
-}
-
-func (t *Tag) setUndefinedScript(id scriptID) {
- if t.script == 0 {
- t.script = id
- }
-}
-
-func (t *Tag) setUndefinedRegion(id regionID) {
- if t.region == 0 || t.region.contains(id) {
- t.region = id
- }
-}
-
-// ErrMissingLikelyTagsData indicates no information was available
-// to compute likely values of missing tags.
-var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
-
-// addLikelySubtags sets subtags to their most likely value, given the locale.
-// In most cases this means setting fields for unknown values, but in some
-// cases it may alter a value. It returns a ErrMissingLikelyTagsData error
-// if the given locale cannot be expanded.
-func (t Tag) addLikelySubtags() (Tag, error) {
- id, err := addTags(t)
- if err != nil {
- return t, err
- } else if id.equalTags(t) {
- return t, nil
- }
- id.remakeString()
- return id, nil
-}
-
-// specializeRegion attempts to specialize a group region.
-func specializeRegion(t *Tag) bool {
- if i := regionInclusion[t.region]; i < nRegionGroups {
- x := likelyRegionGroup[i]
- if langID(x.lang) == t.lang && scriptID(x.script) == t.script {
- t.region = regionID(x.region)
- }
- return true
- }
- return false
-}
-
-func addTags(t Tag) (Tag, error) {
- // We leave private use identifiers alone.
- if t.private() {
- return t, nil
- }
- if t.script != 0 && t.region != 0 {
- if t.lang != 0 {
- // already fully specified
- specializeRegion(&t)
- return t, nil
- }
- // Search matches for und-script-region. Note that for these cases
- // region will never be a group so there is no need to check for this.
- list := likelyRegion[t.region : t.region+1]
- if x := list[0]; x.flags&isList != 0 {
- list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
- }
- for _, x := range list {
- // Deviating from the spec. See match_test.go for details.
- if scriptID(x.script) == t.script {
- t.setUndefinedLang(langID(x.lang))
- return t, nil
- }
- }
- }
- if t.lang != 0 {
- // Search matches for lang-script and lang-region, where lang != und.
- if t.lang < langNoIndexOffset {
- x := likelyLang[t.lang]
- if x.flags&isList != 0 {
- list := likelyLangList[x.region : x.region+uint16(x.script)]
- if t.script != 0 {
- for _, x := range list {
- if scriptID(x.script) == t.script && x.flags&scriptInFrom != 0 {
- t.setUndefinedRegion(regionID(x.region))
- return t, nil
- }
- }
- } else if t.region != 0 {
- count := 0
- goodScript := true
- tt := t
- for _, x := range list {
- // We visit all entries for which the script was not
- // defined, including the ones where the region was not
- // defined. This allows for proper disambiguation within
- // regions.
- if x.flags&scriptInFrom == 0 && t.region.contains(regionID(x.region)) {
- tt.region = regionID(x.region)
- tt.setUndefinedScript(scriptID(x.script))
- goodScript = goodScript && tt.script == scriptID(x.script)
- count++
- }
- }
- if count == 1 {
- return tt, nil
- }
- // Even if we fail to find a unique Region, we might have
- // an unambiguous script.
- if goodScript {
- t.script = tt.script
- }
+ // TODO: this should be an option
+ tt = m.default_.tag
+ if m.preferSameScript {
+ outer:
+ for _, w := range want {
+ script, _ := w.Script()
+ if script.scriptID == 0 {
+ // Don't do anything if there is no script, such as with
+ // private subtags.
+ continue
}
- }
- }
- } else {
- // Search matches for und-script.
- if t.script != 0 {
- x := likelyScript[t.script]
- if x.region != 0 {
- t.setUndefinedRegion(regionID(x.region))
- t.setUndefinedLang(langID(x.lang))
- return t, nil
- }
- }
- // Search matches for und-region. If und-script-region exists, it would
- // have been found earlier.
- if t.region != 0 {
- if i := regionInclusion[t.region]; i < nRegionGroups {
- x := likelyRegionGroup[i]
- if x.region != 0 {
- t.setUndefinedLang(langID(x.lang))
- t.setUndefinedScript(scriptID(x.script))
- t.region = regionID(x.region)
- }
- } else {
- x := likelyRegion[t.region]
- if x.flags&isList != 0 {
- x = likelyRegionList[x.lang]
- }
- if x.script != 0 && x.flags != scriptInFrom {
- t.setUndefinedLang(langID(x.lang))
- t.setUndefinedScript(scriptID(x.script))
- return t, nil
+ for i, h := range m.supported {
+ if script.scriptID == h.maxScript {
+ tt, index = h.tag, i
+ break outer
+ }
}
}
}
+ // TODO: select first language tag based on script.
}
-
- // Search matches for lang.
- if t.lang < langNoIndexOffset {
- x := likelyLang[t.lang]
- if x.flags&isList != 0 {
- x = likelyLangList[x.region]
+ if w.RegionID != tt.RegionID && w.RegionID != 0 {
+ if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) {
+ tt.RegionID = w.RegionID
+ tt.RemakeString()
+ } else if r := w.RegionID.String(); len(r) == 2 {
+ // TODO: also filter macro and deprecated.
+ tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz")
}
- if x.region != 0 {
- t.setUndefinedScript(scriptID(x.script))
- t.setUndefinedRegion(regionID(x.region))
- }
- specializeRegion(&t)
- if t.lang == 0 {
- t.lang = _en // default language
+ }
+ // Copy options from the user-provided tag into the result tag. This is hard
+ // to do after the fact, so we do it here.
+ // TODO: add in alternative variants to -u-va-.
+ // TODO: add preferred region to -u-rg-.
+ if e := w.Extensions(); len(e) > 0 {
+ b := language.Builder{}
+ b.SetTag(tt)
+ for _, e := range e {
+ b.AddExt(e)
}
- return t, nil
+ tt = b.Make()
}
- return t, ErrMissingLikelyTagsData
+ return makeTag(tt), index, c
}
-func (t *Tag) setTagsFrom(id Tag) {
- t.lang = id.lang
- t.script = id.script
- t.region = id.region
-}
+// ErrMissingLikelyTagsData indicates no information was available
+// to compute likely values of missing tags.
+var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
-// minimize removes the region or script subtags from t such that
-// t.addLikelySubtags() == t.minimize().addLikelySubtags().
-func (t Tag) minimize() (Tag, error) {
- t, err := minimizeTags(t)
- if err != nil {
- return t, err
- }
- t.remakeString()
- return t, nil
-}
-
-// minimizeTags mimics the behavior of the ICU 51 C implementation.
-func minimizeTags(t Tag) (Tag, error) {
- if t.equalTags(und) {
- return t, nil
- }
- max, err := addTags(t)
- if err != nil {
- return t, err
- }
- for _, id := range [...]Tag{
- {lang: t.lang},
- {lang: t.lang, region: t.region},
- {lang: t.lang, script: t.script},
- } {
- if x, err := addTags(id); err == nil && max.equalTags(x) {
- t.setTagsFrom(id)
- break
- }
- }
- return t, nil
-}
+// func (t *Tag) setTagsFrom(id Tag) {
+// t.LangID = id.LangID
+// t.ScriptID = id.ScriptID
+// t.RegionID = id.RegionID
+// }
// Tag Matching
// CLDR defines an algorithm for finding the best match between two sets of language
// tags. The basic algorithm defines how to score a possible match and then find
// the match with the best score
-// (see http://www.unicode.org/reports/tr35/#LanguageMatching).
+// (see https://www.unicode.org/reports/tr35/#LanguageMatching).
// Using scoring has several disadvantages. The scoring obfuscates the importance of
// the various factors considered, making the algorithm harder to understand. Using
// scoring also requires the full score to be computed for each pair of tags.
@@ -300,8 +166,9 @@ func minimizeTags(t Tag) (Tag, error) {
// 1) compute the match between the two tags.
// 2) if the match is better than the previous best match, replace it
// with the new match. (see next section)
-// b) if the current best match is above a certain threshold, return this
-// match without proceeding to the next tag in "desired". [See Note 1]
+// b) if the current best match is Exact and pin is true the result will be
+// frozen to the language found thusfar, although better matches may
+// still be found for the same language.
// 3) If the best match so far is below a certain threshold, return "default".
//
// Ranking:
@@ -350,9 +217,6 @@ func minimizeTags(t Tag) (Tag, error) {
// found wins.
//
// Notes:
-// [1] Note that even if we may not have a perfect match, if a match is above a
-// certain threshold, it is considered a better match than any other match
-// to a tag later in the list of preferred language tags.
// [2] In practice, as matching of Exact is done in a separate phase from
// matching the other levels, we reuse the Exact level to mean MaxExact in
// the second phase. As a consequence, we only need the levels defined by
@@ -388,22 +252,24 @@ func minimizeTags(t Tag) (Tag, error) {
// matcher keeps a set of supported language tags, indexed by language.
type matcher struct {
- default_ *haveTag
- index map[langID]*matchHeader
- passSettings bool
+ default_ *haveTag
+ supported []*haveTag
+ index map[language.Language]*matchHeader
+ passSettings bool
+ preferSameScript bool
}
// matchHeader has the lists of tags for exact matches and matches based on
// maximized and canonicalized tags for a given language.
type matchHeader struct {
- exact []*haveTag
- max []*haveTag
+ haveTags []*haveTag
+ original bool
}
// haveTag holds a supported Tag and its maximized script and region. The maximized
// or canonicalized language is not stored as it is not needed during matching.
type haveTag struct {
- tag Tag
+ tag language.Tag
// index of this tag in the original list of supported tags.
index int
@@ -413,35 +279,37 @@ type haveTag struct {
conf Confidence
// Maximized region and script.
- maxRegion regionID
- maxScript scriptID
+ maxRegion language.Region
+ maxScript language.Script
// altScript may be checked as an alternative match to maxScript. If altScript
// matches, the confidence level for this match is Low. Theoretically there
// could be multiple alternative scripts. This does not occur in practice.
- altScript scriptID
+ altScript language.Script
// nextMax is the index of the next haveTag with the same maximized tags.
nextMax uint16
}
-func makeHaveTag(tag Tag, index int) (haveTag, langID) {
+func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) {
max := tag
- if tag.lang != 0 {
- max, _ = max.canonicalize(All)
- max, _ = addTags(max)
- max.remakeString()
+ if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 {
+ max, _ = canonicalize(All, max)
+ max, _ = max.Maximize()
+ max.RemakeString()
}
- return haveTag{tag, index, Exact, max.region, max.script, altScript(max.lang, max.script), 0}, max.lang
+ return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID
}
// altScript returns an alternative script that may match the given script with
// a low confidence. At the moment, the langMatch data allows for at most one
// script to map to another and we rely on this to keep the code simple.
-func altScript(l langID, s scriptID) scriptID {
+func altScript(l language.Language, s language.Script) language.Script {
for _, alt := range matchScript {
- if (alt.lang == 0 || langID(alt.lang) == l) && scriptID(alt.have) == s {
- return scriptID(alt.want)
+ // TODO: also match cases where language is not the same.
+ if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) &&
+ language.Script(alt.haveScript) == s {
+ return language.Script(alt.wantScript)
}
}
return 0
@@ -450,34 +318,32 @@ func altScript(l langID, s scriptID) scriptID {
// addIfNew adds a haveTag to the list of tags only if it is a unique tag.
// Tags that have the same maximized values are linked by index.
func (h *matchHeader) addIfNew(n haveTag, exact bool) {
+ h.original = h.original || exact
// Don't add new exact matches.
- for _, v := range h.exact {
- if v.tag.equalsRest(n.tag) {
+ for _, v := range h.haveTags {
+ if equalsRest(v.tag, n.tag) {
return
}
}
- if exact {
- h.exact = append(h.exact, &n)
- }
// Allow duplicate maximized tags, but create a linked list to allow quickly
// comparing the equivalents and bail out.
- for i, v := range h.max {
+ for i, v := range h.haveTags {
if v.maxScript == n.maxScript &&
v.maxRegion == n.maxRegion &&
- v.tag.variantOrPrivateTagStr() == n.tag.variantOrPrivateTagStr() {
- for h.max[i].nextMax != 0 {
- i = int(h.max[i].nextMax)
+ v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() {
+ for h.haveTags[i].nextMax != 0 {
+ i = int(h.haveTags[i].nextMax)
}
- h.max[i].nextMax = uint16(len(h.max))
+ h.haveTags[i].nextMax = uint16(len(h.haveTags))
break
}
}
- h.max = append(h.max, &n)
+ h.haveTags = append(h.haveTags, &n)
}
// header returns the matchHeader for the given language. It creates one if
// it doesn't already exist.
-func (m *matcher) header(l langID) *matchHeader {
+func (m *matcher) header(l language.Language) *matchHeader {
if h := m.index[l]; h != nil {
return h
}
@@ -486,12 +352,26 @@ func (m *matcher) header(l langID) *matchHeader {
return h
}
+func toConf(d uint8) Confidence {
+ if d <= 10 {
+ return High
+ }
+ if d < 30 {
+ return Low
+ }
+ return No
+}
+
// newMatcher builds an index for the given supported tags and returns it as
// a matcher. It also expands the index by considering various equivalence classes
// for a given tag.
-func newMatcher(supported []Tag) *matcher {
+func newMatcher(supported []Tag, options []MatchOption) *matcher {
m := &matcher{
- index: make(map[langID]*matchHeader),
+ index: make(map[language.Language]*matchHeader),
+ preferSameScript: true,
+ }
+ for _, o := range options {
+ o(m)
}
if len(supported) == 0 {
m.default_ = &haveTag{}
@@ -500,36 +380,41 @@ func newMatcher(supported []Tag) *matcher {
// Add supported languages to the index. Add exact matches first to give
// them precedence.
for i, tag := range supported {
- pair, _ := makeHaveTag(tag, i)
- m.header(tag.lang).addIfNew(pair, true)
- }
- m.default_ = m.header(supported[0].lang).exact[0]
+ tt := tag.tag()
+ pair, _ := makeHaveTag(tt, i)
+ m.header(tt.LangID).addIfNew(pair, true)
+ m.supported = append(m.supported, &pair)
+ }
+ m.default_ = m.header(supported[0].lang()).haveTags[0]
+ // Keep these in two different loops to support the case that two equivalent
+ // languages are distinguished, such as iw and he.
for i, tag := range supported {
- pair, max := makeHaveTag(tag, i)
- if max != tag.lang {
- m.header(max).addIfNew(pair, false)
+ tt := tag.tag()
+ pair, max := makeHaveTag(tt, i)
+ if max != tt.LangID {
+ m.header(max).addIfNew(pair, true)
}
}
// update is used to add indexes in the map for equivalent languages.
- // If force is true, the update will also apply to derived entries. To
- // avoid applying a "transitive closure", use false.
- update := func(want, have uint16, conf Confidence, force bool) {
- if hh := m.index[langID(have)]; hh != nil {
- if !force && len(hh.exact) == 0 {
+ // update will only add entries to original indexes, thus not computing any
+ // transitive relations.
+ update := func(want, have uint16, conf Confidence) {
+ if hh := m.index[language.Language(have)]; hh != nil {
+ if !hh.original {
return
}
- hw := m.header(langID(want))
- for _, ht := range hh.max {
+ hw := m.header(language.Language(want))
+ for _, ht := range hh.haveTags {
v := *ht
if conf < v.conf {
v.conf = conf
}
v.nextMax = 0 // this value needs to be recomputed
if v.altScript != 0 {
- v.altScript = altScript(langID(want), v.maxScript)
+ v.altScript = altScript(language.Language(want), v.maxScript)
}
- hw.addIfNew(v, conf == Exact && len(hh.exact) > 0)
+ hw.addIfNew(v, conf == Exact && hh.original)
}
}
}
@@ -537,9 +422,9 @@ func newMatcher(supported []Tag) *matcher {
// Add entries for languages with mutual intelligibility as defined by CLDR's
// languageMatch data.
for _, ml := range matchLang {
- update(ml.want, ml.have, Confidence(ml.conf), false)
+ update(ml.want, ml.have, toConf(ml.distance))
if !ml.oneway {
- update(ml.have, ml.want, Confidence(ml.conf), false)
+ update(ml.have, ml.want, toConf(ml.distance))
}
}
@@ -548,126 +433,157 @@ func newMatcher(supported []Tag) *matcher {
// First we match deprecated equivalents. If they are perfect equivalents
// (their canonicalization simply substitutes a different language code, but
// nothing else), the match confidence is Exact, otherwise it is High.
- for i, lm := range langAliasMap {
- if lm.from == _sh {
- continue
- }
-
+ for i, lm := range language.AliasMap {
// If deprecated codes match and there is no fiddling with the script or
// or region, we consider it an exact match.
conf := Exact
- if langAliasTypes[i] != langMacro {
- if !isExactEquivalent(langID(lm.from)) {
+ if language.AliasTypes[i] != language.Macro {
+ if !isExactEquivalent(language.Language(lm.From)) {
conf = High
}
- update(lm.to, lm.from, conf, true)
+ update(lm.To, lm.From, conf)
}
- update(lm.from, lm.to, conf, true)
+ update(lm.From, lm.To, conf)
}
return m
}
// getBest gets the best matching tag in m for any of the given tags, taking into
// account the order of preference of the given tags.
-func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) {
+func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) {
best := bestMatch{}
- for _, w := range want {
- var max Tag
+ for i, ww := range want {
+ w := ww.tag()
+ var max language.Tag
// Check for exact match first.
- h := m.index[w.lang]
- if w.lang != 0 {
- // Base language is defined.
+ h := m.index[w.LangID]
+ if w.LangID != 0 {
if h == nil {
continue
}
- for i := range h.exact {
- have := h.exact[i]
- if have.tag.equalsRest(w) {
- return have, w, Exact
- }
+ // Base language is defined.
+ max, _ = canonicalize(Legacy|Deprecated|Macro, w)
+ // A region that is added through canonicalization is stronger than
+ // a maximized region: set it in the original (e.g. mo -> ro-MD).
+ if w.RegionID != max.RegionID {
+ w.RegionID = max.RegionID
}
- max, _ = w.canonicalize(Legacy | Deprecated)
- max, _ = addTags(max)
+ // TODO: should we do the same for scripts?
+ // See test case: en, sr, nl ; sh ; sr
+ max, _ = max.Maximize()
} else {
// Base language is not defined.
if h != nil {
- for i := range h.exact {
- have := h.exact[i]
- if have.tag.equalsRest(w) {
+ for i := range h.haveTags {
+ have := h.haveTags[i]
+ if equalsRest(have.tag, w) {
return have, w, Exact
}
}
}
- if w.script == 0 && w.region == 0 {
+ if w.ScriptID == 0 && w.RegionID == 0 {
// We skip all tags matching und for approximate matching, including
// private tags.
continue
}
- max, _ = addTags(w)
- if h = m.index[max.lang]; h == nil {
+ max, _ = w.Maximize()
+ if h = m.index[max.LangID]; h == nil {
continue
}
}
+ pin := true
+ for _, t := range want[i+1:] {
+ if w.LangID == t.lang() {
+ pin = false
+ break
+ }
+ }
// Check for match based on maximized tag.
- for i := range h.max {
- have := h.max[i]
- best.update(have, w, max.script, max.region)
+ for i := range h.haveTags {
+ have := h.haveTags[i]
+ best.update(have, w, max.ScriptID, max.RegionID, pin)
if best.conf == Exact {
for have.nextMax != 0 {
- have = h.max[have.nextMax]
- best.update(have, w, max.script, max.region)
+ have = h.haveTags[have.nextMax]
+ best.update(have, w, max.ScriptID, max.RegionID, pin)
}
- return best.have, best.want, High
+ return best.have, best.want, best.conf
}
}
}
if best.conf <= No {
if len(want) != 0 {
- return nil, want[0], No
+ return nil, want[0].tag(), No
}
- return nil, Tag{}, No
+ return nil, language.Tag{}, No
}
return best.have, best.want, best.conf
}
// bestMatch accumulates the best match so far.
type bestMatch struct {
- have *haveTag
- want Tag
- conf Confidence
+ have *haveTag
+ want language.Tag
+ conf Confidence
+ pinnedRegion language.Region
+ pinLanguage bool
+ sameRegionGroup bool
// Cached results from applying tie-breaking rules.
- origLang bool
- origReg bool
- regDist uint8
- origScript bool
- parentDist uint8 // 255 if have is not an ancestor of want tag.
+ origLang bool
+ origReg bool
+ paradigmReg bool
+ regGroupDist uint8
+ origScript bool
}
// update updates the existing best match if the new pair is considered to be a
-// better match.
-// To determine if the given pair is a better match, it first computes the rough
-// confidence level. If this surpasses the current match, it will replace it and
-// update the tie-breaker rule cache. If there is a tie, it proceeds with applying
-// a series of tie-breaker rules. If there is no conclusive winner after applying
-// the tie-breaker rules, it leaves the current match as the preferred match.
-func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion regionID) {
+// better match. To determine if the given pair is a better match, it first
+// computes the rough confidence level. If this surpasses the current match, it
+// will replace it and update the tie-breaker rule cache. If there is a tie, it
+// proceeds with applying a series of tie-breaker rules. If there is no
+// conclusive winner after applying the tie-breaker rules, it leaves the current
+// match as the preferred match.
+//
+// If pin is true and have and tag are a strong match, it will henceforth only
+// consider matches for this language. This corresponds to the nothing that most
+// users have a strong preference for the first defined language. A user can
+// still prefer a second language over a dialect of the preferred language by
+// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should
+// be false.
+func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) {
// Bail if the maximum attainable confidence is below that of the current best match.
c := have.conf
if c < m.conf {
return
}
- if have.maxScript != maxScript {
+ // Don't change the language once we already have found an exact match.
+ if m.pinLanguage && tag.LangID != m.want.LangID {
+ return
+ }
+ // Pin the region group if we are comparing tags for the same language.
+ if tag.LangID == m.want.LangID && m.sameRegionGroup {
+ _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID)
+ if !sameGroup {
+ return
+ }
+ }
+ if c == Exact && have.maxScript == maxScript {
+ // If there is another language and then another entry of this language,
+ // don't pin anything, otherwise pin the language.
+ m.pinLanguage = pin
+ }
+ if equalsRest(have.tag, tag) {
+ } else if have.maxScript != maxScript {
// There is usually very little comprehension between different scripts.
- // In a few cases there may still be Low comprehension. This possibility is
- // pre-computed and stored in have.altScript.
+ // In a few cases there may still be Low comprehension. This possibility
+ // is pre-computed and stored in have.altScript.
if Low < m.conf || have.altScript != maxScript {
return
}
c = Low
} else if have.maxRegion != maxRegion {
- // There is usually a small difference between languages across regions.
- // We use the region distance (below) to disambiguate between equal matches.
if High < c {
+ // There is usually a small difference between languages across regions.
c = High
}
}
@@ -686,7 +602,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion
// Tie-breaker rules:
// We prefer if the pre-maximized language was specified and identical.
- origLang := have.tag.lang == tag.lang && tag.lang != 0
+ origLang := have.tag.LangID == tag.LangID && tag.LangID != 0
if !beaten && m.origLang != origLang {
if m.origLang {
return
@@ -695,7 +611,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion
}
// We prefer if the pre-maximized region was specified and identical.
- origReg := have.tag.region == tag.region && tag.region != 0
+ origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0
if !beaten && m.origReg != origReg {
if m.origReg {
return
@@ -703,28 +619,26 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion
beaten = true
}
- // Next we prefer smaller distances between regions, as defined by regionDist.
- regDist := regionDist(have.maxRegion, maxRegion, tag.lang)
- if !beaten && m.regDist != regDist {
- if regDist > m.regDist {
+ regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID)
+ if !beaten && m.regGroupDist != regGroupDist {
+ if regGroupDist > m.regGroupDist {
return
}
beaten = true
}
- // Next we prefer if the pre-maximized script was specified and identical.
- origScript := have.tag.script == tag.script && tag.script != 0
- if !beaten && m.origScript != origScript {
- if m.origScript {
+ paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion)
+ if !beaten && m.paradigmReg != paradigmReg {
+ if !paradigmReg {
return
}
beaten = true
}
- // Finally we prefer tags which have a closer parent relationship.
- parentDist := parentDistance(have.tag.region, tag)
- if !beaten && m.parentDist != parentDist {
- if parentDist > m.parentDist {
+ // Next we prefer if the pre-maximized script was specified and identical.
+ origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0
+ if !beaten && m.origScript != origScript {
+ if m.origScript {
return
}
beaten = true
@@ -735,90 +649,59 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion
m.have = have
m.want = tag
m.conf = c
+ m.pinnedRegion = maxRegion
+ m.sameRegionGroup = sameGroup
m.origLang = origLang
m.origReg = origReg
+ m.paradigmReg = paradigmReg
m.origScript = origScript
- m.regDist = regDist
- m.parentDist = parentDist
+ m.regGroupDist = regGroupDist
}
}
-// parentDistance returns the number of times Parent must be called before the
-// regions match. It is assumed that it has already been checked that lang and
-// script are identical. If haveRegion does not occur in the ancestor chain of
-// tag, it returns 255.
-func parentDistance(haveRegion regionID, tag Tag) uint8 {
- p := tag.Parent()
- d := uint8(1)
- for haveRegion != p.region {
- if p.region == 0 {
- return 255
+func isParadigmLocale(lang language.Language, r language.Region) bool {
+ for _, e := range paradigmLocales {
+ if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) {
+ return true
}
- p = p.Parent()
- d++
- }
- return d
-}
-
-// regionDist wraps regionDistance with some exceptions to the algorithmic distance.
-func regionDist(a, b regionID, lang langID) uint8 {
- if lang == _en {
- // Two variants of non-US English are close to each other, regardless of distance.
- if a != _US && b != _US {
- return 2
- }
- }
- return uint8(regionDistance(a, b))
-}
-
-// regionDistance computes the distance between two regions based on the
-// distance in the graph of region containments as defined in CLDR. It iterates
-// over increasingly inclusive sets of groups, represented as bit vectors, until
-// the source bit vector has bits in common with the destination vector.
-func regionDistance(a, b regionID) int {
- if a == b {
- return 0
- }
- p, q := regionInclusion[a], regionInclusion[b]
- if p < nRegionGroups {
- p, q = q, p
- }
- set := regionInclusionBits
- if q < nRegionGroups && set[p]&(1<<q) != 0 {
- return 1
- }
- d := 2
- for goal := set[q]; set[p]&goal == 0; p = regionInclusionNext[p] {
- d++
}
- return d
+ return false
}
-func (t Tag) variants() string {
- if t.pVariant == 0 {
- return ""
- }
- return t.str[t.pVariant:t.pExt]
-}
+// regionGroupDist computes the distance between two regions based on their
+// CLDR grouping.
+func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) {
+ const defaultDistance = 4
-// variantOrPrivateTagStr returns variants or private use tags.
-func (t Tag) variantOrPrivateTagStr() string {
- if t.pExt > 0 {
- return t.str[t.pVariant:t.pExt]
+ aGroup := uint(regionToGroups[a]) << 1
+ bGroup := uint(regionToGroups[b]) << 1
+ for _, ri := range matchRegion {
+ if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) {
+ group := uint(1 << (ri.group &^ 0x80))
+ if 0x80&ri.group == 0 {
+ if aGroup&bGroup&group != 0 { // Both regions are in the group.
+ return ri.distance, ri.distance == defaultDistance
+ }
+ } else {
+ if (aGroup|bGroup)&group == 0 { // Both regions are not in the group.
+ return ri.distance, ri.distance == defaultDistance
+ }
+ }
+ }
}
- return t.str[t.pVariant:]
+ return defaultDistance, true
}
// equalsRest compares everything except the language.
-func (a Tag) equalsRest(b Tag) bool {
+func equalsRest(a, b language.Tag) bool {
// TODO: don't include extensions in this comparison. To do this efficiently,
// though, we should handle private tags separately.
- return a.script == b.script && a.region == b.region && a.variantOrPrivateTagStr() == b.variantOrPrivateTagStr()
+ return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags()
}
// isExactEquivalent returns true if canonicalizing the language will not alter
// the script or region of a tag.
-func isExactEquivalent(l langID) bool {
+func isExactEquivalent(l language.Language) bool {
for _, o := range notEquivalent {
if o == l {
return false
@@ -827,15 +710,26 @@ func isExactEquivalent(l langID) bool {
return true
}
-var notEquivalent []langID
+var notEquivalent []language.Language
func init() {
// Create a list of all languages for which canonicalization may alter the
// script or region.
- for _, lm := range langAliasMap {
- tag := Tag{lang: langID(lm.from)}
- if tag, _ = tag.canonicalize(All); tag.script != 0 || tag.region != 0 {
- notEquivalent = append(notEquivalent, langID(lm.from))
+ for _, lm := range language.AliasMap {
+ tag := language.Tag{LangID: language.Language(lm.From)}
+ if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 {
+ notEquivalent = append(notEquivalent, language.Language(lm.From))
+ }
+ }
+ // Maximize undefined regions of paradigm locales.
+ for i, v := range paradigmLocales {
+ t := language.Tag{LangID: language.Language(v[0])}
+ max, _ := t.Maximize()
+ if v[1] == 0 {
+ paradigmLocales[i][1] = uint16(max.RegionID)
+ }
+ if v[2] == 0 {
+ paradigmLocales[i][2] = uint16(max.RegionID)
}
}
}
diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go
index cfa28f56e..11acfd885 100644
--- a/vendor/golang.org/x/text/language/parse.go
+++ b/vendor/golang.org/x/text/language/parse.go
@@ -5,216 +5,21 @@
package language
import (
- "bytes"
"errors"
- "fmt"
- "sort"
"strconv"
"strings"
- "golang.org/x/text/internal/tag"
+ "golang.org/x/text/internal/language"
)
-// isAlpha returns true if the byte is not a digit.
-// b must be an ASCII letter or digit.
-func isAlpha(b byte) bool {
- return b > '9'
-}
-
-// isAlphaNum returns true if the string contains only ASCII letters or digits.
-func isAlphaNum(s []byte) bool {
- for _, c := range s {
- if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
- return false
- }
- }
- return true
-}
-
-// errSyntax is returned by any of the parsing functions when the
-// input is not well-formed, according to BCP 47.
-// TODO: return the position at which the syntax error occurred?
-var errSyntax = errors.New("language: tag is not well-formed")
-
// ValueError is returned by any of the parsing functions when the
// input is well-formed but the respective subtag is not recognized
// as a valid value.
-type ValueError struct {
- v [8]byte
-}
-
-func mkErrInvalid(s []byte) error {
- var e ValueError
- copy(e.v[:], s)
- return e
-}
-
-func (e ValueError) tag() []byte {
- n := bytes.IndexByte(e.v[:], 0)
- if n == -1 {
- n = 8
- }
- return e.v[:n]
-}
-
-// Error implements the error interface.
-func (e ValueError) Error() string {
- return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
-}
-
-// Subtag returns the subtag for which the error occurred.
-func (e ValueError) Subtag() string {
- return string(e.tag())
-}
-
-// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
-type scanner struct {
- b []byte
- bytes [max99thPercentileSize]byte
- token []byte
- start int // start position of the current token
- end int // end position of the current token
- next int // next point for scan
- err error
- done bool
-}
-
-func makeScannerString(s string) scanner {
- scan := scanner{}
- if len(s) <= len(scan.bytes) {
- scan.b = scan.bytes[:copy(scan.bytes[:], s)]
- } else {
- scan.b = []byte(s)
- }
- scan.init()
- return scan
-}
-
-// makeScanner returns a scanner using b as the input buffer.
-// b is not copied and may be modified by the scanner routines.
-func makeScanner(b []byte) scanner {
- scan := scanner{b: b}
- scan.init()
- return scan
-}
-
-func (s *scanner) init() {
- for i, c := range s.b {
- if c == '_' {
- s.b[i] = '-'
- }
- }
- s.scan()
-}
-
-// restToLower converts the string between start and end to lower case.
-func (s *scanner) toLower(start, end int) {
- for i := start; i < end; i++ {
- c := s.b[i]
- if 'A' <= c && c <= 'Z' {
- s.b[i] += 'a' - 'A'
- }
- }
-}
+type ValueError interface {
+ error
-func (s *scanner) setError(e error) {
- if s.err == nil || (e == errSyntax && s.err != errSyntax) {
- s.err = e
- }
-}
-
-// resizeRange shrinks or grows the array at position oldStart such that
-// a new string of size newSize can fit between oldStart and oldEnd.
-// Sets the scan point to after the resized range.
-func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
- s.start = oldStart
- if end := oldStart + newSize; end != oldEnd {
- diff := end - oldEnd
- if end < cap(s.b) {
- b := make([]byte, len(s.b)+diff)
- copy(b, s.b[:oldStart])
- copy(b[end:], s.b[oldEnd:])
- s.b = b
- } else {
- s.b = append(s.b[end:], s.b[oldEnd:]...)
- }
- s.next = end + (s.next - s.end)
- s.end = end
- }
-}
-
-// replace replaces the current token with repl.
-func (s *scanner) replace(repl string) {
- s.resizeRange(s.start, s.end, len(repl))
- copy(s.b[s.start:], repl)
-}
-
-// gobble removes the current token from the input.
-// Caller must call scan after calling gobble.
-func (s *scanner) gobble(e error) {
- s.setError(e)
- if s.start == 0 {
- s.b = s.b[:+copy(s.b, s.b[s.next:])]
- s.end = 0
- } else {
- s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
- s.end = s.start - 1
- }
- s.next = s.start
-}
-
-// deleteRange removes the given range from s.b before the current token.
-func (s *scanner) deleteRange(start, end int) {
- s.setError(errSyntax)
- s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
- diff := end - start
- s.next -= diff
- s.start -= diff
- s.end -= diff
-}
-
-// scan parses the next token of a BCP 47 string. Tokens that are larger
-// than 8 characters or include non-alphanumeric characters result in an error
-// and are gobbled and removed from the output.
-// It returns the end position of the last token consumed.
-func (s *scanner) scan() (end int) {
- end = s.end
- s.token = nil
- for s.start = s.next; s.next < len(s.b); {
- i := bytes.IndexByte(s.b[s.next:], '-')
- if i == -1 {
- s.end = len(s.b)
- s.next = len(s.b)
- i = s.end - s.start
- } else {
- s.end = s.next + i
- s.next = s.end + 1
- }
- token := s.b[s.start:s.end]
- if i < 1 || i > 8 || !isAlphaNum(token) {
- s.gobble(errSyntax)
- continue
- }
- s.token = token
- return end
- }
- if n := len(s.b); n > 0 && s.b[n-1] == '-' {
- s.setError(errSyntax)
- s.b = s.b[:len(s.b)-1]
- }
- s.done = true
- return end
-}
-
-// acceptMinSize parses multiple tokens of the given size or greater.
-// It returns the end position of the last token consumed.
-func (s *scanner) acceptMinSize(min int) (end int) {
- end = s.end
- s.scan()
- for ; len(s.token) >= min; s.scan() {
- end = s.end
- }
- return end
+ // Subtag returns the subtag for which the error occurred.
+ Subtag() string
}
// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
@@ -223,7 +28,7 @@ func (s *scanner) acceptMinSize(min int) (end int) {
// ValueError. The Tag returned in this case is just stripped of the unknown
// value. All other values are preserved. It accepts tags in the BCP 47 format
// and extensions to this standard defined in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
// The resulting tag is canonicalized using the default canonicalization type.
func Parse(s string) (t Tag, err error) {
return Default.Parse(s)
@@ -235,327 +40,18 @@ func Parse(s string) (t Tag, err error) {
// ValueError. The Tag returned in this case is just stripped of the unknown
// value. All other values are preserved. It accepts tags in the BCP 47 format
// and extensions to this standard defined in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-// The resulting tag is canonicalized using the the canonicalization type c.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// The resulting tag is canonicalized using the canonicalization type c.
func (c CanonType) Parse(s string) (t Tag, err error) {
- // TODO: consider supporting old-style locale key-value pairs.
- if s == "" {
- return und, errSyntax
- }
- if len(s) <= maxAltTaglen {
- b := [maxAltTaglen]byte{}
- for i, c := range s {
- // Generating invalid UTF-8 is okay as it won't match.
- if 'A' <= c && c <= 'Z' {
- c += 'a' - 'A'
- } else if c == '_' {
- c = '-'
- }
- b[i] = byte(c)
- }
- if t, ok := grandfathered(b); ok {
- return t, nil
- }
+ tt, err := language.Parse(s)
+ if err != nil {
+ return makeTag(tt), err
}
- scan := makeScannerString(s)
- t, err = parse(&scan, s)
- t, changed := t.canonicalize(c)
+ tt, changed := canonicalize(c, tt)
if changed {
- t.remakeString()
- }
- return t, err
-}
-
-func parse(scan *scanner, s string) (t Tag, err error) {
- t = und
- var end int
- if n := len(scan.token); n <= 1 {
- scan.toLower(0, len(scan.b))
- if n == 0 || scan.token[0] != 'x' {
- return t, errSyntax
- }
- end = parseExtensions(scan)
- } else if n >= 4 {
- return und, errSyntax
- } else { // the usual case
- t, end = parseTag(scan)
- if n := len(scan.token); n == 1 {
- t.pExt = uint16(end)
- end = parseExtensions(scan)
- } else if end < len(scan.b) {
- scan.setError(errSyntax)
- scan.b = scan.b[:end]
- }
- }
- if int(t.pVariant) < len(scan.b) {
- if end < len(s) {
- s = s[:end]
- }
- if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
- t.str = s
- } else {
- t.str = string(scan.b)
- }
- } else {
- t.pVariant, t.pExt = 0, 0
- }
- return t, scan.err
-}
-
-// parseTag parses language, script, region and variants.
-// It returns a Tag and the end position in the input that was parsed.
-func parseTag(scan *scanner) (t Tag, end int) {
- var e error
- // TODO: set an error if an unknown lang, script or region is encountered.
- t.lang, e = getLangID(scan.token)
- scan.setError(e)
- scan.replace(t.lang.String())
- langStart := scan.start
- end = scan.scan()
- for len(scan.token) == 3 && isAlpha(scan.token[0]) {
- // From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
- // to a tag of the form <extlang>.
- lang, e := getLangID(scan.token)
- if lang != 0 {
- t.lang = lang
- copy(scan.b[langStart:], lang.String())
- scan.b[langStart+3] = '-'
- scan.start = langStart + 4
- }
- scan.gobble(e)
- end = scan.scan()
- }
- if len(scan.token) == 4 && isAlpha(scan.token[0]) {
- t.script, e = getScriptID(script, scan.token)
- if t.script == 0 {
- scan.gobble(e)
- }
- end = scan.scan()
- }
- if n := len(scan.token); n >= 2 && n <= 3 {
- t.region, e = getRegionID(scan.token)
- if t.region == 0 {
- scan.gobble(e)
- } else {
- scan.replace(t.region.String())
- }
- end = scan.scan()
- }
- scan.toLower(scan.start, len(scan.b))
- t.pVariant = byte(end)
- end = parseVariants(scan, end, t)
- t.pExt = uint16(end)
- return t, end
-}
-
-var separator = []byte{'-'}
-
-// parseVariants scans tokens as long as each token is a valid variant string.
-// Duplicate variants are removed.
-func parseVariants(scan *scanner, end int, t Tag) int {
- start := scan.start
- varIDBuf := [4]uint8{}
- variantBuf := [4][]byte{}
- varID := varIDBuf[:0]
- variant := variantBuf[:0]
- last := -1
- needSort := false
- for ; len(scan.token) >= 4; scan.scan() {
- // TODO: measure the impact of needing this conversion and redesign
- // the data structure if there is an issue.
- v, ok := variantIndex[string(scan.token)]
- if !ok {
- // unknown variant
- // TODO: allow user-defined variants?
- scan.gobble(mkErrInvalid(scan.token))
- continue
- }
- varID = append(varID, v)
- variant = append(variant, scan.token)
- if !needSort {
- if last < int(v) {
- last = int(v)
- } else {
- needSort = true
- // There is no legal combinations of more than 7 variants
- // (and this is by no means a useful sequence).
- const maxVariants = 8
- if len(varID) > maxVariants {
- break
- }
- }
- }
- end = scan.end
- }
- if needSort {
- sort.Sort(variantsSort{varID, variant})
- k, l := 0, -1
- for i, v := range varID {
- w := int(v)
- if l == w {
- // Remove duplicates.
- continue
- }
- varID[k] = varID[i]
- variant[k] = variant[i]
- k++
- l = w
- }
- if str := bytes.Join(variant[:k], separator); len(str) == 0 {
- end = start - 1
- } else {
- scan.resizeRange(start, end, len(str))
- copy(scan.b[scan.start:], str)
- end = scan.end
- }
- }
- return end
-}
-
-type variantsSort struct {
- i []uint8
- v [][]byte
-}
-
-func (s variantsSort) Len() int {
- return len(s.i)
-}
-
-func (s variantsSort) Swap(i, j int) {
- s.i[i], s.i[j] = s.i[j], s.i[i]
- s.v[i], s.v[j] = s.v[j], s.v[i]
-}
-
-func (s variantsSort) Less(i, j int) bool {
- return s.i[i] < s.i[j]
-}
-
-type bytesSort [][]byte
-
-func (b bytesSort) Len() int {
- return len(b)
-}
-
-func (b bytesSort) Swap(i, j int) {
- b[i], b[j] = b[j], b[i]
-}
-
-func (b bytesSort) Less(i, j int) bool {
- return bytes.Compare(b[i], b[j]) == -1
-}
-
-// parseExtensions parses and normalizes the extensions in the buffer.
-// It returns the last position of scan.b that is part of any extension.
-// It also trims scan.b to remove excess parts accordingly.
-func parseExtensions(scan *scanner) int {
- start := scan.start
- exts := [][]byte{}
- private := []byte{}
- end := scan.end
- for len(scan.token) == 1 {
- extStart := scan.start
- ext := scan.token[0]
- end = parseExtension(scan)
- extension := scan.b[extStart:end]
- if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
- scan.setError(errSyntax)
- end = extStart
- continue
- } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
- scan.b = scan.b[:end]
- return end
- } else if ext == 'x' {
- private = extension
- break
- }
- exts = append(exts, extension)
+ tt.RemakeString()
}
- sort.Sort(bytesSort(exts))
- if len(private) > 0 {
- exts = append(exts, private)
- }
- scan.b = scan.b[:start]
- if len(exts) > 0 {
- scan.b = append(scan.b, bytes.Join(exts, separator)...)
- } else if start > 0 {
- // Strip trailing '-'.
- scan.b = scan.b[:start-1]
- }
- return end
-}
-
-// parseExtension parses a single extension and returns the position of
-// the extension end.
-func parseExtension(scan *scanner) int {
- start, end := scan.start, scan.end
- switch scan.token[0] {
- case 'u':
- attrStart := end
- scan.scan()
- for last := []byte{}; len(scan.token) > 2; scan.scan() {
- if bytes.Compare(scan.token, last) != -1 {
- // Attributes are unsorted. Start over from scratch.
- p := attrStart + 1
- scan.next = p
- attrs := [][]byte{}
- for scan.scan(); len(scan.token) > 2; scan.scan() {
- attrs = append(attrs, scan.token)
- end = scan.end
- }
- sort.Sort(bytesSort(attrs))
- copy(scan.b[p:], bytes.Join(attrs, separator))
- break
- }
- last = scan.token
- end = scan.end
- }
- var last, key []byte
- for attrEnd := end; len(scan.token) == 2; last = key {
- key = scan.token
- keyEnd := scan.end
- end = scan.acceptMinSize(3)
- // TODO: check key value validity
- if keyEnd == end || bytes.Compare(key, last) != 1 {
- // We have an invalid key or the keys are not sorted.
- // Start scanning keys from scratch and reorder.
- p := attrEnd + 1
- scan.next = p
- keys := [][]byte{}
- for scan.scan(); len(scan.token) == 2; {
- keyStart, keyEnd := scan.start, scan.end
- end = scan.acceptMinSize(3)
- if keyEnd != end {
- keys = append(keys, scan.b[keyStart:end])
- } else {
- scan.setError(errSyntax)
- end = keyStart
- }
- }
- sort.Sort(bytesSort(keys))
- reordered := bytes.Join(keys, separator)
- if e := p + len(reordered); e < end {
- scan.deleteRange(e, end)
- end = e
- }
- copy(scan.b[p:], bytes.Join(keys, separator))
- break
- }
- }
- case 't':
- scan.scan()
- if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
- _, end = parseTag(scan)
- scan.toLower(start, end)
- }
- for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
- end = scan.acceptMinSize(3)
- }
- case 'x':
- end = scan.acceptMinSize(1)
- default:
- end = scan.acceptMinSize(2)
- }
- return end
+ return makeTag(tt), err
}
// Compose creates a Tag from individual parts, which may be of type Tag, Base,
@@ -563,10 +59,11 @@ func parseExtension(scan *scanner) int {
// Base, Script or Region or slice of type Variant or Extension is passed more
// than once, the latter will overwrite the former. Variants and Extensions are
// accumulated, but if two extensions of the same type are passed, the latter
-// will replace the former. A Tag overwrites all former values and typically
-// only makes sense as the first argument. The resulting tag is returned after
-// canonicalizing using the Default CanonType. If one or more errors are
-// encountered, one of the errors is returned.
+// will replace the former. For -u extensions, though, the key-type pairs are
+// added, where later values overwrite older ones. A Tag overwrites all former
+// values and typically only makes sense as the first argument. The resulting
+// tag is returned after canonicalizing using the Default CanonType. If one or
+// more errors are encountered, one of the errors is returned.
func Compose(part ...interface{}) (t Tag, err error) {
return Default.Compose(part...)
}
@@ -576,196 +73,68 @@ func Compose(part ...interface{}) (t Tag, err error) {
// Base, Script or Region or slice of type Variant or Extension is passed more
// than once, the latter will overwrite the former. Variants and Extensions are
// accumulated, but if two extensions of the same type are passed, the latter
-// will replace the former. A Tag overwrites all former values and typically
-// only makes sense as the first argument. The resulting tag is returned after
-// canonicalizing using CanonType c. If one or more errors are encountered,
-// one of the errors is returned.
+// will replace the former. For -u extensions, though, the key-type pairs are
+// added, where later values overwrite older ones. A Tag overwrites all former
+// values and typically only makes sense as the first argument. The resulting
+// tag is returned after canonicalizing using CanonType c. If one or more errors
+// are encountered, one of the errors is returned.
func (c CanonType) Compose(part ...interface{}) (t Tag, err error) {
- var b builder
- if err = b.update(part...); err != nil {
+ var b language.Builder
+ if err = update(&b, part...); err != nil {
return und, err
}
- t, _ = b.tag.canonicalize(c)
-
- if len(b.ext) > 0 || len(b.variant) > 0 {
- sort.Sort(sortVariant(b.variant))
- sort.Strings(b.ext)
- if b.private != "" {
- b.ext = append(b.ext, b.private)
- }
- n := maxCoreSize + tokenLen(b.variant...) + tokenLen(b.ext...)
- buf := make([]byte, n)
- p := t.genCoreBytes(buf)
- t.pVariant = byte(p)
- p += appendTokens(buf[p:], b.variant...)
- t.pExt = uint16(p)
- p += appendTokens(buf[p:], b.ext...)
- t.str = string(buf[:p])
- } else if b.private != "" {
- t.str = b.private
- t.remakeString()
- }
- return
-}
-
-type builder struct {
- tag Tag
-
- private string // the x extension
- ext []string
- variant []string
-
- err error
-}
-
-func (b *builder) addExt(e string) {
- if e == "" {
- } else if e[0] == 'x' {
- b.private = e
- } else {
- b.ext = append(b.ext, e)
- }
+ b.Tag, _ = canonicalize(c, b.Tag)
+ return makeTag(b.Make()), err
}
var errInvalidArgument = errors.New("invalid Extension or Variant")
-func (b *builder) update(part ...interface{}) (err error) {
- replace := func(l *[]string, s string, eq func(a, b string) bool) bool {
- if s == "" {
- b.err = errInvalidArgument
- return true
- }
- for i, v := range *l {
- if eq(v, s) {
- (*l)[i] = s
- return true
- }
- }
- return false
- }
+func update(b *language.Builder, part ...interface{}) (err error) {
for _, x := range part {
switch v := x.(type) {
case Tag:
- b.tag.lang = v.lang
- b.tag.region = v.region
- b.tag.script = v.script
- if v.str != "" {
- b.variant = nil
- for x, s := "", v.str[v.pVariant:v.pExt]; s != ""; {
- x, s = nextToken(s)
- b.variant = append(b.variant, x)
- }
- b.ext, b.private = nil, ""
- for i, e := int(v.pExt), ""; i < len(v.str); {
- i, e = getExtension(v.str, i)
- b.addExt(e)
- }
- }
+ b.SetTag(v.tag())
case Base:
- b.tag.lang = v.langID
+ b.Tag.LangID = v.langID
case Script:
- b.tag.script = v.scriptID
+ b.Tag.ScriptID = v.scriptID
case Region:
- b.tag.region = v.regionID
+ b.Tag.RegionID = v.regionID
case Variant:
- if !replace(&b.variant, v.variant, func(a, b string) bool { return a == b }) {
- b.variant = append(b.variant, v.variant)
+ if v.variant == "" {
+ err = errInvalidArgument
+ break
}
+ b.AddVariant(v.variant)
case Extension:
- if !replace(&b.ext, v.s, func(a, b string) bool { return a[0] == b[0] }) {
- b.addExt(v.s)
+ if v.s == "" {
+ err = errInvalidArgument
+ break
}
+ b.SetExt(v.s)
case []Variant:
- b.variant = nil
- for _, x := range v {
- b.update(x)
+ b.ClearVariants()
+ for _, v := range v {
+ b.AddVariant(v.variant)
}
case []Extension:
- b.ext, b.private = nil, ""
+ b.ClearExtensions()
for _, e := range v {
- b.update(e)
+ b.SetExt(e.s)
}
// TODO: support parsing of raw strings based on morphology or just extensions?
case error:
- err = v
- }
- }
- return
-}
-
-func tokenLen(token ...string) (n int) {
- for _, t := range token {
- n += len(t) + 1
- }
- return
-}
-
-func appendTokens(b []byte, token ...string) int {
- p := 0
- for _, t := range token {
- b[p] = '-'
- copy(b[p+1:], t)
- p += 1 + len(t)
- }
- return p
-}
-
-type sortVariant []string
-
-func (s sortVariant) Len() int {
- return len(s)
-}
-
-func (s sortVariant) Swap(i, j int) {
- s[j], s[i] = s[i], s[j]
-}
-
-func (s sortVariant) Less(i, j int) bool {
- return variantIndex[s[i]] < variantIndex[s[j]]
-}
-
-func findExt(list []string, x byte) int {
- for i, e := range list {
- if e[0] == x {
- return i
- }
- }
- return -1
-}
-
-// getExtension returns the name, body and end position of the extension.
-func getExtension(s string, p int) (end int, ext string) {
- if s[p] == '-' {
- p++
- }
- if s[p] == 'x' {
- return len(s), s[p:]
- }
- end = nextExtension(s, p)
- return end, s[p:end]
-}
-
-// nextExtension finds the next extension within the string, searching
-// for the -<char>- pattern from position p.
-// In the fast majority of cases, language tags will have at most
-// one extension and extensions tend to be small.
-func nextExtension(s string, p int) int {
- for n := len(s) - 3; p < n; {
- if s[p] == '-' {
- if s[p+2] == '-' {
- return p
+ if v != nil {
+ err = v
}
- p += 3
- } else {
- p++
}
}
- return len(s)
+ return
}
var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight")
-// ParseAcceptLanguage parses the contents of a Accept-Language header as
+// ParseAcceptLanguage parses the contents of an Accept-Language header as
// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and
// a list of corresponding quality weights. It is more permissive than RFC 2616
// and may return non-nil slices even if the input is not valid.
@@ -788,7 +157,7 @@ func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) {
if !ok {
return nil, nil, err
}
- t = Tag{lang: id}
+ t = makeTag(language.Tag{LangID: id})
}
// Scan the optional weight.
@@ -830,9 +199,9 @@ func split(s string, c byte) (head, tail string) {
return strings.TrimSpace(s), ""
}
-// Add hack mapping to deal with a small number of cases that that occur
+// Add hack mapping to deal with a small number of cases that occur
// in Accept-Language (with reasonable frequency).
-var acceptFallback = map[string]langID{
+var acceptFallback = map[string]language.Language{
"english": _en,
"deutsch": _de,
"italian": _it,
diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go
index ccdc1ff0f..e22807719 100644
--- a/vendor/golang.org/x/text/language/tables.go
+++ b/vendor/golang.org/x/text/language/tables.go
@@ -1,3547 +1,298 @@
-// This file was generated by go generate; DO NOT EDIT
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
package language
-import "golang.org/x/text/internal/tag"
-
// CLDRVersion is the CLDR version from which the tables in this package are derived.
-const CLDRVersion = "30"
-
-const numLanguages = 8654
-
-const numScripts = 230
-
-const numRegions = 356
-
-type fromTo struct {
- from uint16
- to uint16
-}
+const CLDRVersion = "32"
-const nonCanonicalUnd = 1191
const (
- _af = 21
- _am = 38
- _ar = 57
- _az = 87
- _bg = 125
- _bn = 163
- _ca = 213
- _cs = 246
- _da = 253
- _de = 265
- _el = 305
- _en = 308
- _es = 313
- _et = 315
- _fa = 323
- _fi = 332
- _fil = 334
- _fr = 345
- _gu = 413
- _he = 437
- _hi = 439
- _hr = 458
- _hu = 462
- _hy = 464
- _id = 474
- _is = 496
- _it = 497
- _ja = 504
- _ka = 520
- _kk = 570
- _km = 578
- _kn = 585
- _ko = 587
- _ky = 641
- _lo = 687
- _lt = 695
- _lv = 702
- _mk = 758
- _ml = 763
- _mn = 770
- _mo = 775
- _mr = 786
- _ms = 790
- _mul = 797
- _my = 808
- _nb = 830
- _ne = 840
- _nl = 862
- _no = 870
- _pa = 916
- _pl = 938
- _pt = 951
- _ro = 979
- _ru = 985
- _sh = 1021
- _si = 1026
- _sk = 1032
- _sl = 1036
- _sq = 1063
- _sr = 1064
- _sv = 1082
- _sw = 1083
- _ta = 1094
- _te = 1111
- _th = 1121
- _tl = 1136
- _tn = 1142
- _tr = 1152
- _uk = 1188
- _ur = 1194
- _uz = 1202
- _vi = 1209
- _zh = 1311
- _zu = 1316
- _jbo = 507
- _ami = 1639
- _bnn = 2346
- _hak = 431
- _tlh = 14456
- _lb = 652
- _nv = 890
- _pwn = 12044
- _tao = 14177
- _tay = 14187
- _tsu = 14651
- _nn = 865
- _sfb = 13618
- _vgt = 15690
- _sgg = 13649
- _cmn = 2996
- _nan = 826
- _hsn = 460
+ _de = 269
+ _en = 313
+ _fr = 350
+ _it = 505
+ _mo = 784
+ _no = 879
+ _nb = 839
+ _pt = 960
+ _sh = 1031
+ _mul = 806
+ _und = 0
+)
+const (
+ _001 = 1
+ _419 = 31
+ _BR = 65
+ _CA = 73
+ _ES = 110
+ _GB = 123
+ _MD = 188
+ _PT = 238
+ _UK = 306
+ _US = 309
+ _ZZ = 357
+ _XA = 323
+ _XC = 325
+ _XK = 333
)
-
-const langPrivateStart = 0x2f67
-
-const langPrivateEnd = 0x316e
-
-// lang holds an alphabetically sorted list of ISO-639 language identifiers.
-// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
-// For 2-byte language identifiers, the two successive bytes have the following meaning:
-// - if the first letter of the 2- and 3-letter ISO codes are the same:
-// the second and third letter of the 3-letter ISO code.
-// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
-// For 3-byte language identifiers the 4th byte is 0.
-const lang tag.Index = "" + // Size: 5280 bytes
- "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abr\x00abt\x00aby\x00acd\x00a" +
- "ce\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey\x00affrag" +
- "c\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00ajg\x00akka" +
- "akk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00amp\x00anrga" +
- "nc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00ape\x00apr" +
- "\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars\x00ary\x00a" +
- "rz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00atj\x00auy" +
- "\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx\x00ayymayb" +
- "\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00bba\x00bbb" +
- "\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bcm\x00bcn" +
- "\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00bet\x00b" +
- "ew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn\x00bgx" +
- "\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib\x00big" +
- "\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn\x00bjo" +
- "\x00bjr\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt\x00bmambmh\x00b" +
- "mk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00bom\x00bon\x00bp" +
- "y\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx\x00brz\x00bsosbsj" +
- "\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00buc\x00bud\x00bug" +
- "\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr\x00bxh\x00bye" +
- "\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf\x00bzh\x00bzw" +
- "\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg\x00chhachk\x00" +
- "chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00ckl\x00cko\x00ck" +
- "y\x00cla\x00cme\x00cooscop\x00cps\x00crrecrj\x00crk\x00crl\x00crm\x00crs" +
- "\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymdaandad\x00daf\x00dag\x00dah" +
- "\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00ddn\x00deeuded\x00den\x00d" +
- "ga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia\x00dje\x00dnj\x00dob\x00doi" +
- "\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm\x00dtp\x00dts\x00dty\x00dua" +
- "\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00dyo\x00dyu\x00dzzodzg\x00ebu" +
- "\x00eeweefi\x00egl\x00egy\x00eky\x00elllema\x00emi\x00enngenn\x00enq\x00" +
- "eopoeri\x00es\x00\x05esu\x00etstetr\x00ett\x00etu\x00etx\x00euusewo\x00e" +
- "xt\x00faasfaa\x00fab\x00fag\x00fai\x00fan\x00ffulffi\x00ffm\x00fiinfia" +
- "\x00fil\x00fit\x00fjijflr\x00fmp\x00foaofod\x00fon\x00for\x00fpe\x00fqs" +
- "\x00frrafrc\x00frp\x00frr\x00frs\x00fub\x00fud\x00fue\x00fuf\x00fuh\x00f" +
- "uq\x00fur\x00fuv\x00fuy\x00fvr\x00fyrygalegaa\x00gaf\x00gag\x00gah\x00ga" +
- "j\x00gam\x00gan\x00gaw\x00gay\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdla" +
- "gde\x00gdn\x00gdr\x00geb\x00gej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gi" +
- "l\x00gim\x00gjk\x00gjn\x00gju\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00" +
- "gnrngnd\x00gng\x00god\x00gof\x00goi\x00gom\x00gon\x00gor\x00gos\x00got" +
- "\x00grc\x00grt\x00grw\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00g" +
- "ux\x00guz\x00gvlvgvf\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauha" +
- "g\x00hak\x00ham\x00haw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif" +
- "\x00hig\x00hih\x00hil\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj" +
- "\x00hnn\x00hno\x00homohoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui" +
- "\x00hyyehzerianaian\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd" +
- "\x00idi\x00idu\x00ieleigboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw" +
- "\x00ikx\x00ilo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00" +
- "\x03iwm\x00iws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00j" +
- "gk\x00jgo\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatka" +
- "a\x00kab\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp" +
- "\x00kbq\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl" +
- "\x00kdt\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00k" +
- "gp\x00kha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij" +
- "\x00kiu\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klal" +
- "kln\x00klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw" +
- "\x00knanknp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
- "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
- "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
- "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
- "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
- "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
- "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
- "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
- "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
- "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
- "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
- "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
- "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
- "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
- "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
- "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
- "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
- "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
- "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
- "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
- "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
- "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
- "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
- "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
- "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
- "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
- "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
- "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
- "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
- "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
- "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
- "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
- "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
- "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
- "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
- "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
- "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
- "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
- "\x00sah\x00saq\x00sas\x00sat\x00saz\x00sba\x00sbe\x00sbp\x00scrdsck\x00s" +
- "cl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00sei\x00se" +
- "s\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn\x00shu" +
- "\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks\x00sllv" +
- "sld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp\x00smq" +
- "\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq\x00sou" +
- "\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx\x00sssw" +
- "ssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00sur\x00s" +
- "us\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00syl\x00sy" +
- "r\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf\x00tbg\x00" +
- "tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelted\x00tem" +
- "\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00thq\x00thr" +
- "\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr\x00tkt" +
- "\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00tog\x00" +
- "toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssotsd\x00t" +
- "sf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts\x00ttt" +
- "\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00twq\x00t" +
- "xg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli\x00umb" +
- "\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00uvh\x00u" +
- "vl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv\x00vls" +
- "\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj\x00wal" +
- "\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg\x00wib" +
- "\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu\x00woolw" +
- "ob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00xbi\x00xcr" +
- "\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna\x00xnr\x00x" +
- "og\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe\x00yam\x00yao" +
- "\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb\x00yby\x00yer" +
- "\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00yooryon\x00yrb" +
- "\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw\x00zahazag\x00z" +
- "bl\x00zdj\x00zea\x00zgh\x00zhhozia\x00zlm\x00zmi\x00zne\x00zuulzxx\x00zz" +
- "a\x00\xff\xff\xff\xff"
-
-const langNoIndexOffset = 1319
-
-// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
-// in lookup tables. The language ids for these language codes are derived directly
-// from the letters and are not consecutive.
-// Size: 2197 bytes, 2197 elements
-var langNoIndex = [2197]uint8{
- // Entry 0 - 3F
- 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd7, 0x3b, 0xd2,
- 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
- 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
- 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
- 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
- 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
- 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
- 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
- // Entry 40 - 7F
- 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
- 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
- 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
- 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
- 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
- 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
- 0xa8, 0xff, 0x1f, 0x67, 0x7f, 0xeb, 0xef, 0xce,
- 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
- // Entry 80 - BF
- 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
- 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
- 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
- 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
- 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
- 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
- 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
- 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
- // Entry C0 - FF
- 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
- 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56,
- 0x45, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
- 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
- 0xbc, 0x87, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
- 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
- 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
- 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
- // Entry 100 - 13F
- 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
- 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
- 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
- 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
- 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
- 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
- 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
- 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
- // Entry 140 - 17F
- 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16,
- 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
- 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
- 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
- 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
- 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
- 0x00, 0x00, 0x50, 0xd5, 0x2d, 0x00, 0x64, 0x35,
- 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
- // Entry 180 - 1BF
- 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
- 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
- 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
- // Entry 1C0 - 1FF
- 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
- 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
- 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
- 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
- 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7e, 0xbf,
- // Entry 200 - 23F
- 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
- 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
- 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xcf, 0xe0, 0xdf,
- 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3,
- 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d,
- 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
- 0x21, 0x12, 0x6c, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
- 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
- // Entry 240 - 27F
- 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
- 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0,
- 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
- 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
- 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
- 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
- 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66,
- // Entry 280 - 2BF
- 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
- 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
- 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
- 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
- 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
- 0xe5, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
- 0x03, 0x00, 0x00, 0x00, 0xcc, 0x50, 0x40, 0x04,
- 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
- // Entry 2C0 - 2FF
- 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
- 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
- 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
- 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
- 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
- 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
- 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
- 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
- // Entry 300 - 33F
- 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
- 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
- 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
- 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
- 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
- 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
- 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
- 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
- // Entry 340 - 37F
- 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
- 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
- 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
- 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
- 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
- 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
- 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0xff,
- 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
- // Entry 380 - 3BF
- 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
- 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
- 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
- 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
- 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
- 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
- 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
- 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
- // Entry 3C0 - 3FF
- 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
- 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
- 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
- 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
- 0x84, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
- 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
- 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
- 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
- // Entry 400 - 43F
- 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
- 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
- 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
- 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
- 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
- 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
- 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
- 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
- // Entry 440 - 47F
- 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
- 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
- 0x7f, 0x4e, 0xbf, 0x8e, 0xae, 0xff, 0xee, 0xdf,
- 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
- 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
- 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd,
- 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
- 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x04, 0x44,
- // Entry 480 - 4BF
- 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb,
- 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
- 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
- 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
- 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
- 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
- 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
- // Entry 4C0 - 4FF
- 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
- 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
- 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
- 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
- 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
- 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
- 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
- // Entry 500 - 53F
- 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
- 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
- 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
- 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7,
- 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
- 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
- 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
- 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
- // Entry 540 - 57F
- 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- // Entry 580 - 5BF
- 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
- 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
- 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
- 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
- 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
- 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
- 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
- 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
- // Entry 5C0 - 5FF
- 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
- 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
- 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
- 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
- 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
- 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
- 0x00, 0x1f, 0xdf, 0xf2, 0xb9, 0xff, 0xfd, 0x3f,
- 0x1f, 0x18, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe,
- // Entry 600 - 63F
- 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
- 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
- 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
- 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
- 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
- 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
- 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
- 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
- // Entry 640 - 67F
- 0x75, 0xc4, 0x7d, 0x81, 0x82, 0xf1, 0x57, 0x6c,
- 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
- 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98,
- 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
- 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
- 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
- 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
- 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
- // Entry 680 - 6BF
- 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
- 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda,
- 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
- 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
- 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
- 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
- 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
- 0x04, 0x00, 0x10, 0x8c, 0x58, 0xd5, 0x0d, 0x0f,
- // Entry 6C0 - 6FF
- 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
- 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
- 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41,
- 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
- 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
- 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
- // Entry 700 - 73F
- 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
- 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
- 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
- 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
- 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
- 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 740 - 77F
- 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
- 0xa0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
- 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
- 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
- 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
- 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
- 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
- // Entry 780 - 7BF
- 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
- 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
- 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
- 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
- 0x78, 0x15, 0x50, 0x00, 0xa4, 0x84, 0xa9, 0x41,
- 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
- 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
- 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
- // Entry 7C0 - 7FF
- 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42,
- 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56,
- 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
- 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
- 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
- 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
- 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
- 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
- // Entry 800 - 83F
- 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
- 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
- 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
- 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
- 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
- 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
- 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
- 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
- // Entry 840 - 87F
- 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
- 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
- 0x84, 0x00, 0x23, 0xc0, 0x23, 0x24, 0x00, 0x00,
- 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
- 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
- 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
- 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
- // Entry 880 - 8BF
- 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
- 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
- 0x0a, 0x00, 0x80, 0x00, 0x00,
-}
-
-// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
-// to 2-letter language codes that cannot be derived using the method described above.
-// Each 3-letter code is followed by its 1-byte langID.
-const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
-
-// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
-// Size: 12 bytes, 6 elements
-var altLangIndex = [6]uint16{
- 0x0278, 0x03fd, 0x01f3, 0x03dc, 0x0139, 0x0200,
-}
-
-// langAliasMap maps langIDs to their suggested replacements.
-// Size: 644 bytes, 161 elements
-var langAliasMap = [161]fromTo{
- 0: {from: 0x81, to: 0x87},
- 1: {from: 0x181, to: 0x1a7},
- 2: {from: 0x1eb, to: 0x1da},
- 3: {from: 0x1f3, to: 0x1b5},
- 4: {from: 0x200, to: 0x508},
- 5: {from: 0x207, to: 0x206},
- 6: {from: 0x307, to: 0x3d3},
- 7: {from: 0x33e, to: 0x366},
- 8: {from: 0x3fd, to: 0x428},
- 9: {from: 0x470, to: 0x14e},
- 10: {from: 0x486, to: 0x447},
- 11: {from: 0x498, to: 0x20},
- 12: {from: 0x533, to: 0x539},
- 13: {from: 0x584, to: 0x129},
- 14: {from: 0x625, to: 0x1ea6},
- 15: {from: 0x646, to: 0x427},
- 16: {from: 0x657, to: 0x427},
- 17: {from: 0x6e2, to: 0x39},
- 18: {from: 0x6ed, to: 0x1d0},
- 19: {from: 0x733, to: 0x2196},
- 20: {from: 0x7a8, to: 0x55},
- 21: {from: 0x7ae, to: 0x2990},
- 22: {from: 0x7ba, to: 0x57},
- 23: {from: 0x7db, to: 0x140},
- 24: {from: 0x801, to: 0x59},
- 25: {from: 0x80a, to: 0x8c},
- 26: {from: 0x873, to: 0x805},
- 27: {from: 0x8b8, to: 0xed8},
- 28: {from: 0x9e4, to: 0x328},
- 29: {from: 0xa2b, to: 0x2bc},
- 30: {from: 0xa32, to: 0xbd},
- 31: {from: 0xab3, to: 0x3317},
- 32: {from: 0xb2d, to: 0x51f},
- 33: {from: 0xb6a, to: 0x264f},
- 34: {from: 0xb73, to: 0xbb8},
- 35: {from: 0xb90, to: 0x444},
- 36: {from: 0xbb1, to: 0x421e},
- 37: {from: 0xbb4, to: 0x51f},
- 38: {from: 0xbf3, to: 0x2d9c},
- 39: {from: 0xc23, to: 0x3176},
- 40: {from: 0xcae, to: 0xf0},
- 41: {from: 0xcfd, to: 0xf6},
- 42: {from: 0xdbd, to: 0x116},
- 43: {from: 0xdcc, to: 0x324},
- 44: {from: 0xded, to: 0xdf0},
- 45: {from: 0xdf3, to: 0x526},
- 46: {from: 0xed4, to: 0x204f},
- 47: {from: 0xee3, to: 0x2e8f},
- 48: {from: 0xf2e, to: 0x35e},
- 49: {from: 0x10c5, to: 0x13b},
- 50: {from: 0x10f9, to: 0x2c7},
- 51: {from: 0x1195, to: 0x1e4},
- 52: {from: 0x126e, to: 0x20},
- 53: {from: 0x1419, to: 0x159},
- 54: {from: 0x1465, to: 0x149},
- 55: {from: 0x1514, to: 0xd90},
- 56: {from: 0x1518, to: 0x387},
- 57: {from: 0x1527, to: 0x16ba},
- 58: {from: 0x1575, to: 0x208},
- 59: {from: 0x1578, to: 0x109},
- 60: {from: 0x1598, to: 0x3ca4},
- 61: {from: 0x165f, to: 0x195},
- 62: {from: 0x16bd, to: 0x131},
- 63: {from: 0x16f5, to: 0x29ed},
- 64: {from: 0x170d, to: 0x18e},
- 65: {from: 0x171c, to: 0xf34},
- 66: {from: 0x176f, to: 0x1519},
- 67: {from: 0x17fe, to: 0x17ab},
- 68: {from: 0x180b, to: 0x18e8},
- 69: {from: 0x187f, to: 0x42c},
- 70: {from: 0x196e, to: 0x1cf6},
- 71: {from: 0x1a69, to: 0x2ba5},
- 72: {from: 0x1a7f, to: 0x1f0},
- 73: {from: 0x1b4f, to: 0x1f2},
- 74: {from: 0x1b7b, to: 0x150a},
- 75: {from: 0x202d, to: 0x37a6},
- 76: {from: 0x2032, to: 0x20d2},
- 77: {from: 0x204f, to: 0x302},
- 78: {from: 0x20d8, to: 0x26b},
- 79: {from: 0x20e3, to: 0x25a},
- 80: {from: 0x20e7, to: 0x225},
- 81: {from: 0x20ee, to: 0x24d},
- 82: {from: 0x2104, to: 0x21e0},
- 83: {from: 0x212a, to: 0x274},
- 84: {from: 0x218e, to: 0x11d},
- 85: {from: 0x21c3, to: 0x1556},
- 86: {from: 0x21db, to: 0x4fa},
- 87: {from: 0x21e9, to: 0x495},
- 88: {from: 0x2222, to: 0x11d},
- 89: {from: 0x222c, to: 0x11d},
- 90: {from: 0x2257, to: 0x91f},
- 91: {from: 0x230b, to: 0x321b},
- 92: {from: 0x2377, to: 0x335a},
- 93: {from: 0x2467, to: 0x2be},
- 94: {from: 0x24d9, to: 0x2f6},
- 95: {from: 0x24e5, to: 0x2f1},
- 96: {from: 0x24ef, to: 0x316},
- 97: {from: 0x2545, to: 0xb50},
- 98: {from: 0x259e, to: 0xe0},
- 99: {from: 0x2633, to: 0x2c7},
- 100: {from: 0x26be, to: 0x26a9},
- 101: {from: 0x26ee, to: 0x3bf},
- 102: {from: 0x271c, to: 0x3ca4},
- 103: {from: 0x275a, to: 0x26a9},
- 104: {from: 0x277e, to: 0x434d},
- 105: {from: 0x28e4, to: 0x282c},
- 106: {from: 0x2909, to: 0x348},
- 107: {from: 0x297b, to: 0x2d9c},
- 108: {from: 0x2b0f, to: 0x384},
- 109: {from: 0x2bf1, to: 0x38c},
- 110: {from: 0x2c34, to: 0x3ca4},
- 111: {from: 0x2cf1, to: 0x3b5},
- 112: {from: 0x2d08, to: 0x58c},
- 113: {from: 0x2d3c, to: 0x143},
- 114: {from: 0x2d3d, to: 0x143},
- 115: {from: 0x2df4, to: 0x2e8},
- 116: {from: 0x2dfd, to: 0x19c1},
- 117: {from: 0x2e0f, to: 0x2d8a},
- 118: {from: 0x2e16, to: 0x289},
- 119: {from: 0x2e49, to: 0x7c},
- 120: {from: 0x2e5a, to: 0x2277},
- 121: {from: 0x2e95, to: 0x2e90},
- 122: {from: 0x2ee4, to: 0x2ecc},
- 123: {from: 0x3188, to: 0x3bb},
- 124: {from: 0x335b, to: 0x3383},
- 125: {from: 0x341f, to: 0x3d3},
- 126: {from: 0x34e3, to: 0x18c5},
- 127: {from: 0x35db, to: 0x408},
- 128: {from: 0x364d, to: 0x23e},
- 129: {from: 0x366b, to: 0x3ea},
- 130: {from: 0x36f2, to: 0x43b},
- 131: {from: 0x37b5, to: 0x11d},
- 132: {from: 0x380b, to: 0x38e7},
- 133: {from: 0x3820, to: 0x2c90},
- 134: {from: 0x3824, to: 0xa7},
- 135: {from: 0x3827, to: 0x321d},
- 136: {from: 0x3861, to: 0x399b},
- 137: {from: 0x3887, to: 0x3fb5},
- 138: {from: 0x389a, to: 0x39cc},
- 139: {from: 0x38a9, to: 0x1f99},
- 140: {from: 0x38aa, to: 0x2e8f},
- 141: {from: 0x3951, to: 0x474},
- 142: {from: 0x3b43, to: 0xd86},
- 143: {from: 0x3b6d, to: 0x132},
- 144: {from: 0x3c8e, to: 0x4b2},
- 145: {from: 0x3fb2, to: 0xfc},
- 146: {from: 0x41fd, to: 0xa86},
- 147: {from: 0x42b3, to: 0x568},
- 148: {from: 0x42ee, to: 0x3f55},
- 149: {from: 0x436d, to: 0x251},
- 150: {from: 0x43c0, to: 0x36c0},
- 151: {from: 0x43c2, to: 0x10b},
- 152: {from: 0x44a4, to: 0x3317},
- 153: {from: 0x44d8, to: 0x508},
- 154: {from: 0x45bf, to: 0x23fe},
- 155: {from: 0x45d2, to: 0x26d1},
- 156: {from: 0x4605, to: 0x48a3},
- 157: {from: 0x46a3, to: 0x4695},
- 158: {from: 0x4733, to: 0x473a},
- 159: {from: 0x490b, to: 0x316},
- 160: {from: 0x499c, to: 0x519},
-}
-
-// Size: 161 bytes, 161 elements
-var langAliasTypes = [161]langAliasType{
- // Entry 0 - 3F
- 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
- 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0,
- 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0,
- 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0,
- // Entry 40 - 7F
- 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 1, 1, 1,
- 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 2, 2,
- 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, 0, 1,
- 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 2,
- // Entry 80 - BF
- 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, 0,
- 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, 1,
- 1,
-}
-
const (
- _Latn = 82
- _Hani = 50
- _Hans = 52
- _Hant = 53
- _Qaaa = 131
- _Qaai = 139
- _Qabx = 180
- _Zinh = 224
- _Zyyy = 229
- _Zzzz = 230
+ _Latn = 87
+ _Hani = 54
+ _Hans = 56
+ _Hant = 57
+ _Qaaa = 139
+ _Qaai = 147
+ _Qabx = 188
+ _Zinh = 236
+ _Zyyy = 241
+ _Zzzz = 242
)
-// script is an alphabetically sorted list of ISO 15924 codes. The index
-// of the script in the string, divided by 4, is the internal scriptID.
-const script tag.Index = "" + // Size: 928 bytes
- "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
- "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCprtCyrlCyrsDevaDsrtDuplEgyd" +
- "EgyhEgypElbaEthiGeokGeorGlagGothGranGrekGujrGuruHanbHangHaniHanoHansHant" +
- "HatrHebrHiraHluwHmngHrktHungIndsItalJamoJavaJpanJurcKaliKanaKharKhmrKhoj" +
- "KitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepcLimbLinaLinbLisuLoma" +
- "LyciLydiMahjMandManiMarcMayaMendMercMeroMlymModiMongMoonMrooMteiMultMymr" +
- "NarbNbatNewaNkgbNkooNshuOgamOlckOrkhOryaOsgeOsmaPalmPaucPermPhagPhliPhlp" +
- "PhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" +
- "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" +
- "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" +
- "QabxRjngRoroRunrSamrSaraSarbSaurSgnwShawShrdSiddSindSinhSoraSundSyloSyrc" +
- "SyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglgThaaThaiTibtTirh" +
- "UgarVaiiVispWaraWoleXpeoXsuxYiiiZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff" +
- "\xff"
-
-// suppressScript is an index from langID to the dominant script for that language,
-// if it exists. If a script is given, it should be suppressed from the language tag.
-// Size: 1319 bytes, 1319 elements
-var suppressScript = [1319]uint8{
+var regionToGroups = []uint8{ // 357 elements
// Entry 0 - 3F
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x27, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04,
+ 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00,
+ 0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00,
+ 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04,
// Entry 40 - 7F
- 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x1e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00,
+ 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00,
+ 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08,
+ 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00,
// Entry 80 - BF
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00,
+ 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04,
+ 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00,
+ 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00,
// Entry C0 - FF
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01,
+ 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00,
+ 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x52, 0x52, 0x00, 0x00,
// Entry 100 - 13F
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00,
- 0x00, 0xd6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x2d, 0x00, 0x00, 0x52, 0x00, 0x00, 0x52,
- 0x00, 0x52, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
- // Entry 140 - 17F
- 0x52, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
- 0x52, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x52, 0x00, 0x00, 0x52, 0x52, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x52, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 180 - 1BF
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x52, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x52, 0x2e, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x37, 0x00, 0x20,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 1C0 - 1FF
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x52, 0x52, 0x00, 0x52, 0x52, 0x00,
- 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
- 0x52, 0x52, 0x00, 0x37, 0x00, 0x00, 0x00, 0x00,
- 0x41, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 200 - 23F
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x29, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x1e, 0x00, 0x00, 0x52, 0x00, 0x00,
- // Entry 240 - 27F
- 0x00, 0x00, 0x46, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x4a, 0x00, 0x4b, 0x00, 0x20, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 280 - 2BF
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x4f,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
- // Entry 2C0 - 2FF
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00,
- 0x00, 0x00, 0x00, 0x64, 0x00, 0x00, 0x00, 0x00,
- // Entry 300 - 33F
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x52, 0x52,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x6b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
- // Entry 340 - 37F
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x52,
- 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
- 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x70, 0x52, 0x00, 0x00,
- 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
- // Entry 380 - 3BF
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
- 0x00, 0x00, 0x00, 0x00, 0x75, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x2f, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x52,
- 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
- // Entry 3C0 - 3FF
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
- 0x52, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x1e, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 400 - 43F
- 0x00, 0x00, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
- 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
- 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x52, 0x52, 0x00, 0x00, 0x00, 0x00,
- // Entry 440 - 47F
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xcd, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xd0,
- 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0xd5, 0x00, 0x00, 0x00, 0x27, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
- 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x52, 0x00,
- 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
- // Entry 480 - 4BF
- 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00,
- 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 4C0 - 4FF
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00,
+ 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00,
+ 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00,
+ // Entry 140 - 17F
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- // Entry 500 - 53F
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x37, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00,
-}
-
-const (
- _001 = 1
- _419 = 30
- _BR = 64
- _CA = 72
- _ES = 109
- _GB = 122
- _MD = 187
- _PT = 237
- _UK = 305
- _US = 308
- _ZZ = 356
- _XA = 322
- _XC = 324
- _XK = 332
-)
-
-// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
-// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
-// the UN.M49 codes used for groups.)
-const isoRegionOffset = 31
-
-// regionTypes defines the status of a region for various standards.
-// Size: 357 bytes, 357 elements
-var regionTypes = [357]uint8{
- // Entry 0 - 3F
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- // Entry 40 - 7F
- 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, 0x00,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
- 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
- 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- // Entry 80 - BF
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- // Entry C0 - FF
- 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
- 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06,
- 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
- 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
- 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
- // Entry 100 - 13F
- 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06,
- 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
- // Entry 140 - 17F
- 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
- 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
- 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
- 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, 0x04,
- 0x06, 0x06, 0x04, 0x06, 0x05,
-}
-
-// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
-// Each 2-letter codes is followed by two bytes with the following meaning:
-// - [A-Z}{2}: the first letter of the 2-letter code plus these two
-// letters form the 3-letter ISO code.
-// - 0, n: index into altRegionISO3.
-const regionISO tag.Index = "" + // Size: 1308 bytes
- "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
- "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
- "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
- "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
- "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" +
- "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
- "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" +
- "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
- "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
- "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
- "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
- "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
- "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
- "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
- "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
- "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
- "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
- "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
- "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
- "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
-
-// altRegionISO3 holds a list of 3-letter region codes that cannot be
-// mapped to 2-letter codes using the default algorithm. This is a short list.
-const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
-
-// altRegionIDs holds a list of regionIDs the positions of which match those
-// of the 3-letter ISO codes in altRegionISO3.
-// Size: 22 bytes, 11 elements
-var altRegionIDs = [11]uint16{
- 0x0056, 0x006f, 0x0087, 0x00a7, 0x00a9, 0x00ac, 0x00e9, 0x0104,
- 0x0120, 0x015e, 0x00db,
-}
-
-// Size: 80 bytes, 20 elements
-var regionOldMap = [20]fromTo{
- 0: {from: 0x43, to: 0xc3},
- 1: {from: 0x57, to: 0xa6},
- 2: {from: 0x5e, to: 0x5f},
- 3: {from: 0x65, to: 0x3a},
- 4: {from: 0x78, to: 0x77},
- 5: {from: 0x92, to: 0x36},
- 6: {from: 0xa2, to: 0x132},
- 7: {from: 0xc0, to: 0x132},
- 8: {from: 0xd6, to: 0x13e},
- 9: {from: 0xdb, to: 0x2a},
- 10: {from: 0xee, to: 0x132},
- 11: {from: 0xf1, to: 0xe1},
- 12: {from: 0xfb, to: 0x6f},
- 13: {from: 0x102, to: 0x163},
- 14: {from: 0x129, to: 0x125},
- 15: {from: 0x131, to: 0x7a},
- 16: {from: 0x139, to: 0x13d},
- 17: {from: 0x140, to: 0x132},
- 18: {from: 0x15c, to: 0x15d},
- 19: {from: 0x162, to: 0x4a},
-}
-
-// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
-// codes indicating collections of regions.
-// Size: 714 bytes, 357 elements
-var m49 = [357]int16{
- // Entry 0 - 3F
- 0, 1, 2, 3, 5, 9, 11, 13,
- 14, 15, 17, 18, 19, 21, 29, 30,
- 34, 35, 39, 53, 54, 57, 61, 142,
- 143, 145, 150, 151, 154, 155, 419, 958,
- 0, 20, 784, 4, 28, 660, 8, 51,
- 530, 24, 10, 32, 16, 40, 36, 533,
- 248, 31, 70, 52, 50, 56, 854, 100,
- 48, 108, 204, 652, 60, 96, 68, 535,
- // Entry 40 - 7F
- 76, 44, 64, 104, 74, 72, 112, 84,
- 124, 166, 180, 140, 178, 756, 384, 184,
- 152, 120, 156, 170, 0, 188, 891, 296,
- 192, 132, 531, 162, 196, 203, 278, 276,
- 0, 262, 208, 212, 214, 204, 12, 0,
- 218, 233, 818, 732, 232, 724, 231, 967,
- 0, 246, 242, 238, 583, 234, 0, 250,
- 249, 266, 826, 308, 268, 254, 831, 288,
- // Entry 80 - BF
- 292, 304, 270, 324, 312, 226, 300, 239,
- 320, 316, 624, 328, 344, 334, 340, 191,
- 332, 348, 854, 0, 360, 372, 376, 833,
- 356, 86, 368, 364, 352, 380, 832, 388,
- 400, 392, 581, 404, 417, 116, 296, 174,
- 659, 408, 410, 414, 136, 398, 418, 422,
- 662, 438, 144, 430, 426, 440, 442, 428,
- 434, 504, 492, 498, 499, 663, 450, 584,
- // Entry C0 - FF
- 581, 807, 466, 104, 496, 446, 580, 474,
- 478, 500, 470, 480, 462, 454, 484, 458,
- 508, 516, 540, 562, 574, 566, 548, 558,
- 528, 578, 524, 10, 520, 536, 570, 554,
- 512, 591, 0, 604, 258, 598, 608, 586,
- 616, 666, 612, 630, 275, 620, 581, 585,
- 600, 591, 634, 959, 960, 961, 962, 963,
- 964, 965, 966, 967, 968, 969, 970, 971,
- // Entry 100 - 13F
- 972, 638, 716, 642, 688, 643, 646, 682,
- 90, 690, 729, 752, 702, 654, 705, 744,
- 703, 694, 674, 686, 706, 740, 728, 678,
- 810, 222, 534, 760, 748, 0, 796, 148,
- 260, 768, 764, 762, 772, 626, 795, 788,
- 776, 626, 792, 780, 798, 158, 834, 804,
- 800, 826, 581, 0, 840, 858, 860, 336,
- 670, 704, 862, 92, 850, 704, 548, 876,
- // Entry 140 - 17F
- 581, 882, 973, 974, 975, 976, 977, 978,
- 979, 980, 981, 982, 983, 984, 985, 986,
- 987, 988, 989, 990, 991, 992, 993, 994,
- 995, 996, 997, 998, 720, 887, 175, 891,
- 710, 894, 180, 716, 999,
-}
-
-// m49Index gives indexes into fromM49 based on the three most significant bits
-// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
-// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
-// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
-// The region code is stored in the 9 lsb of the indexed value.
-// Size: 18 bytes, 9 elements
-var m49Index = [9]int16{
- 0, 59, 107, 142, 180, 219, 258, 290,
- 332,
-}
-
-// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
-// Size: 664 bytes, 332 elements
-var fromM49 = [332]uint16{
- // Entry 0 - 3F
- 0x0201, 0x0402, 0x0603, 0x0823, 0x0a04, 0x1026, 0x1205, 0x142a,
- 0x1606, 0x1866, 0x1a07, 0x1c08, 0x1e09, 0x202c, 0x220a, 0x240b,
- 0x260c, 0x2821, 0x2a0d, 0x3029, 0x3824, 0x3a0e, 0x3c0f, 0x3e31,
- 0x402b, 0x4410, 0x4611, 0x482e, 0x4e12, 0x502d, 0x5841, 0x6038,
- 0x6434, 0x6627, 0x6833, 0x6a13, 0x6c14, 0x7035, 0x7215, 0x783c,
- 0x7a16, 0x8042, 0x883e, 0x8c32, 0x9045, 0x9444, 0x9840, 0xa847,
- 0xac99, 0xb508, 0xb93b, 0xc03d, 0xc837, 0xd0c3, 0xd839, 0xe046,
- 0xe8a5, 0xf051, 0xf848, 0x0859, 0x10ac, 0x184b, 0x1c17, 0x1e18,
- // Entry 40 - 7F
- 0x20b2, 0x2219, 0x291f, 0x2c1a, 0x2e1b, 0x3050, 0x341c, 0x361d,
- 0x3852, 0x3d2d, 0x445b, 0x4c49, 0x5453, 0x5ca7, 0x5f5e, 0x644c,
- 0x684a, 0x704f, 0x7855, 0x7e8f, 0x8058, 0x885c, 0x965d, 0x983a,
- 0xa062, 0xa863, 0xac64, 0xb468, 0xbd19, 0xc485, 0xcc6e, 0xce6e,
- 0xd06c, 0xd269, 0xd475, 0xdc73, 0xde87, 0xe472, 0xec71, 0xf030,
- 0xf278, 0xf477, 0xfc7d, 0x04e4, 0x0920, 0x0c61, 0x1479, 0x187c,
- 0x1c82, 0x26ec, 0x285f, 0x2c5e, 0x305f, 0x407f, 0x4880, 0x50a6,
- 0x5886, 0x6081, 0x687b, 0x7084, 0x7889, 0x8088, 0x8883, 0x908b,
- // Entry 80 - BF
- 0x9890, 0x9c8d, 0xa137, 0xa88e, 0xb08c, 0xb891, 0xc09c, 0xc898,
- 0xd094, 0xd89b, 0xe09a, 0xe895, 0xf096, 0xf89d, 0x004e, 0x089f,
- 0x10a1, 0x1cad, 0x20a0, 0x28a3, 0x30a9, 0x34aa, 0x3cab, 0x42a4,
- 0x44ae, 0x461e, 0x4caf, 0x54b4, 0x58b7, 0x5cb3, 0x64b8, 0x6cb1,
- 0x70b5, 0x74b6, 0x7cc5, 0x84be, 0x8ccd, 0x94cf, 0x9ccc, 0xa4c2,
- 0xacca, 0xb4c7, 0xbcc8, 0xc0cb, 0xc8ce, 0xd8ba, 0xe0c4, 0xe4bb,
- 0xe6bc, 0xe8c9, 0xf0b9, 0xf8d0, 0x00e0, 0x08d1, 0x10dc, 0x18da,
- 0x20d8, 0x2428, 0x265a, 0x2a2f, 0x2d1a, 0x2e3f, 0x30dd, 0x38d2,
- // Entry C0 - FF
- 0x493e, 0x54df, 0x5cd7, 0x64d3, 0x6cd5, 0x74de, 0x7cd4, 0x84d9,
- 0x88c6, 0x8b32, 0x8e74, 0x90bf, 0x92ef, 0x94e7, 0x9ee1, 0xace5,
- 0xb0f0, 0xb8e3, 0xc0e6, 0xc8ea, 0xd0e8, 0xd8ed, 0xe08a, 0xe525,
- 0xeceb, 0xf4f2, 0xfd01, 0x0503, 0x0705, 0x0d06, 0x183b, 0x1d0d,
- 0x26a8, 0x2825, 0x2cb0, 0x2ebd, 0x34e9, 0x3d38, 0x4512, 0x4d17,
- 0x5507, 0x5d13, 0x6104, 0x6509, 0x6d11, 0x7d0c, 0x7f10, 0x813d,
- 0x830e, 0x8514, 0x8d60, 0x9963, 0xa15c, 0xa86d, 0xb116, 0xb30a,
- 0xb86b, 0xc10a, 0xc915, 0xd10f, 0xd91c, 0xe10b, 0xe84d, 0xf11b,
- // Entry 100 - 13F
- 0xf523, 0xf922, 0x0121, 0x0924, 0x1128, 0x192b, 0x2022, 0x2927,
- 0x312a, 0x3726, 0x391e, 0x3d2c, 0x4130, 0x492f, 0x4ec1, 0x5518,
- 0x646a, 0x747a, 0x7e7e, 0x809e, 0x8297, 0x852e, 0x9134, 0xa53c,
- 0xac36, 0xb535, 0xb936, 0xbd3a, 0xd93f, 0xe541, 0xed5d, 0xef5d,
- 0xf656, 0xfd61, 0x7c1f, 0x7ef3, 0x80f4, 0x82f5, 0x84f6, 0x86f7,
- 0x88f8, 0x8af9, 0x8cfa, 0x8e6f, 0x90fc, 0x92fd, 0x94fe, 0x96ff,
- 0x9900, 0x9b42, 0x9d43, 0x9f44, 0xa145, 0xa346, 0xa547, 0xa748,
- 0xa949, 0xab4a, 0xad4b, 0xaf4c, 0xb14d, 0xb34e, 0xb54f, 0xb750,
- // Entry 140 - 17F
- 0xb951, 0xbb52, 0xbd53, 0xbf54, 0xc155, 0xc356, 0xc557, 0xc758,
- 0xc959, 0xcb5a, 0xcd5b, 0xcf64,
-}
-
-// Size: 1463 bytes
-var variantIndex = map[string]uint8{
- "1606nict": 0x0,
- "1694acad": 0x1,
- "1901": 0x2,
- "1959acad": 0x3,
- "1994": 0x45,
- "1996": 0x4,
- "abl1943": 0x5,
- "alalc97": 0x47,
- "aluku": 0x6,
- "ao1990": 0x7,
- "arevela": 0x8,
- "arevmda": 0x9,
- "baku1926": 0xa,
- "balanka": 0xb,
- "barla": 0xc,
- "basiceng": 0xd,
- "bauddha": 0xe,
- "biscayan": 0xf,
- "biske": 0x40,
- "bohoric": 0x10,
- "boont": 0x11,
- "colb1945": 0x12,
- "cornu": 0x13,
- "dajnko": 0x14,
- "ekavsk": 0x15,
- "emodeng": 0x16,
- "fonipa": 0x48,
- "fonnapa": 0x49,
- "fonupa": 0x4a,
- "fonxsamp": 0x4b,
- "hepburn": 0x17,
- "heploc": 0x46,
- "hognorsk": 0x18,
- "ijekavsk": 0x19,
- "itihasa": 0x1a,
- "jauer": 0x1b,
- "jyutping": 0x1c,
- "kkcor": 0x1d,
- "kociewie": 0x1e,
- "kscor": 0x1f,
- "laukika": 0x20,
- "lipaw": 0x41,
- "luna1918": 0x21,
- "metelko": 0x22,
- "monoton": 0x23,
- "ndyuka": 0x24,
- "nedis": 0x25,
- "newfound": 0x26,
- "njiva": 0x42,
- "nulik": 0x27,
- "osojs": 0x43,
- "oxendict": 0x28,
- "pamaka": 0x29,
- "petr1708": 0x2a,
- "pinyin": 0x2b,
- "polyton": 0x2c,
- "puter": 0x2d,
- "rigik": 0x2e,
- "rozaj": 0x2f,
- "rumgr": 0x30,
- "scotland": 0x31,
- "scouse": 0x32,
- "simple": 0x4c,
- "solba": 0x44,
- "sotav": 0x33,
- "surmiran": 0x34,
- "sursilv": 0x35,
- "sutsilv": 0x36,
- "tarask": 0x37,
- "uccor": 0x38,
- "ucrcor": 0x39,
- "ulster": 0x3a,
- "unifon": 0x3b,
- "vaidika": 0x3c,
- "valencia": 0x3d,
- "vallader": 0x3e,
- "wadegile": 0x3f,
-}
+ 0x00, 0x00, 0x00, 0x00, 0x00,
+} // Size: 381 bytes
-// variantNumSpecialized is the number of specialized variants in variants.
-const variantNumSpecialized = 71
-
-// nRegionGroups is the number of region groups.
-const nRegionGroups = 32
-
-type likelyLangRegion struct {
- lang uint16
- region uint16
-}
-
-// likelyScript is a lookup table, indexed by scriptID, for the most likely
-// languages and regions given a script.
-// Size: 928 bytes, 232 elements
-var likelyScript = [232]likelyLangRegion{
- 1: {lang: 0x149, region: 0x83},
- 3: {lang: 0x299, region: 0x105},
- 4: {lang: 0x1e, region: 0x98},
- 5: {lang: 0x39, region: 0x6a},
- 7: {lang: 0x3a, region: 0x9b},
- 8: {lang: 0x1d0, region: 0x27},
- 9: {lang: 0x12, region: 0x9b},
- 10: {lang: 0x5a, region: 0x94},
- 11: {lang: 0x5f, region: 0x51},
- 12: {lang: 0xb7, region: 0xb3},
- 13: {lang: 0x62, region: 0x94},
- 14: {lang: 0xa3, region: 0x34},
- 15: {lang: 0x3e0, region: 0x98},
- 17: {lang: 0x51f, region: 0x12d},
- 18: {lang: 0x3a8, region: 0x98},
- 19: {lang: 0x159, region: 0x77},
- 20: {lang: 0xc0, region: 0x94},
- 21: {lang: 0x9b, region: 0xe6},
- 22: {lang: 0xd9, region: 0x34},
- 23: {lang: 0xf0, region: 0x48},
- 24: {lang: 0x4e6, region: 0x12a},
- 25: {lang: 0xe5, region: 0x13d},
- 26: {lang: 0xe3, region: 0x134},
- 28: {lang: 0xee, region: 0x6a},
- 29: {lang: 0x199, region: 0x5c},
- 30: {lang: 0x3d9, region: 0x105},
- 32: {lang: 0x1b7, region: 0x98},
- 34: {lang: 0x159, region: 0x77},
- 37: {lang: 0x12f, region: 0x6a},
- 38: {lang: 0x427, region: 0x26},
- 39: {lang: 0x26, region: 0x6e},
- 41: {lang: 0x208, region: 0x7c},
- 42: {lang: 0xfa, region: 0x37},
- 43: {lang: 0x198, region: 0x12f},
- 44: {lang: 0x3e0, region: 0x98},
- 45: {lang: 0x131, region: 0x86},
- 46: {lang: 0x19d, region: 0x98},
- 47: {lang: 0x394, region: 0x98},
- 48: {lang: 0x51f, region: 0x12d},
- 49: {lang: 0x24b, region: 0xaa},
- 50: {lang: 0x51f, region: 0x52},
- 51: {lang: 0x1c4, region: 0xe6},
- 52: {lang: 0x51f, region: 0x52},
- 53: {lang: 0x51f, region: 0x12d},
- 54: {lang: 0x2f4, region: 0x9a},
- 55: {lang: 0x1b5, region: 0x96},
- 56: {lang: 0x1f8, region: 0xa1},
- 57: {lang: 0x1be, region: 0x12a},
- 58: {lang: 0x1c3, region: 0xae},
- 60: {lang: 0x1ce, region: 0x91},
- 62: {lang: 0x13d, region: 0x9d},
- 63: {lang: 0x24b, region: 0xaa},
- 64: {lang: 0x206, region: 0x94},
- 65: {lang: 0x1f8, region: 0xa1},
- 67: {lang: 0x130, region: 0xc3},
- 68: {lang: 0x1f8, region: 0xa1},
- 69: {lang: 0x3b2, region: 0xe7},
- 70: {lang: 0x242, region: 0xa5},
- 71: {lang: 0x3f0, region: 0x98},
- 74: {lang: 0x249, region: 0x98},
- 75: {lang: 0x24b, region: 0xaa},
- 77: {lang: 0x87, region: 0x98},
- 78: {lang: 0x367, region: 0x122},
- 79: {lang: 0x2af, region: 0xae},
- 84: {lang: 0x296, region: 0x98},
- 85: {lang: 0x29f, region: 0x98},
- 86: {lang: 0x286, region: 0x86},
- 87: {lang: 0x199, region: 0x86},
- 88: {lang: 0x2a3, region: 0x52},
- 90: {lang: 0x4ea, region: 0x12a},
- 91: {lang: 0x4eb, region: 0x12a},
- 92: {lang: 0x1b7, region: 0x98},
- 93: {lang: 0x32e, region: 0x9b},
- 94: {lang: 0x4ed, region: 0x52},
- 95: {lang: 0xa7, region: 0x52},
- 97: {lang: 0x2df, region: 0x111},
- 98: {lang: 0x4ee, region: 0x10a},
- 99: {lang: 0x4ee, region: 0x10a},
- 100: {lang: 0x2fb, region: 0x98},
- 101: {lang: 0x312, region: 0x98},
- 102: {lang: 0x302, region: 0x52},
- 104: {lang: 0x315, region: 0x34},
- 105: {lang: 0x305, region: 0x98},
- 106: {lang: 0x40a, region: 0xe7},
- 107: {lang: 0x328, region: 0xc3},
- 108: {lang: 0x4ef, region: 0x107},
- 109: {lang: 0x3a, region: 0xa0},
- 110: {lang: 0x34a, region: 0xda},
- 112: {lang: 0x2c7, region: 0x83},
- 114: {lang: 0x3f9, region: 0x95},
- 115: {lang: 0x3e5, region: 0x98},
- 116: {lang: 0x392, region: 0xc4},
- 117: {lang: 0x38c, region: 0x98},
- 118: {lang: 0x390, region: 0x134},
- 119: {lang: 0x41f, region: 0x114},
- 120: {lang: 0x3a, region: 0x11b},
- 121: {lang: 0xf9, region: 0xc3},
- 122: {lang: 0x274, region: 0x105},
- 123: {lang: 0x2c0, region: 0x52},
- 124: {lang: 0x396, region: 0x9b},
- 125: {lang: 0x396, region: 0x52},
- 127: {lang: 0x3a4, region: 0xaf},
- 129: {lang: 0x1bf, region: 0x52},
- 130: {lang: 0x4f3, region: 0x9b},
- 181: {lang: 0x3c2, region: 0x94},
- 183: {lang: 0x369, region: 0x10b},
- 184: {lang: 0x416, region: 0x96},
- 186: {lang: 0x4f5, region: 0x15d},
- 187: {lang: 0x3e6, region: 0x98},
- 188: {lang: 0x44, region: 0x134},
- 189: {lang: 0x134, region: 0x7a},
- 190: {lang: 0x3e0, region: 0x98},
- 191: {lang: 0x3e0, region: 0x98},
- 192: {lang: 0x3f0, region: 0x98},
- 193: {lang: 0x402, region: 0xb2},
- 194: {lang: 0x429, region: 0x98},
- 195: {lang: 0x434, region: 0x94},
- 196: {lang: 0x443, region: 0x34},
- 197: {lang: 0x444, region: 0x9a},
- 201: {lang: 0x450, region: 0xe6},
- 202: {lang: 0x116, region: 0x98},
- 203: {lang: 0x454, region: 0x52},
- 204: {lang: 0x22a, region: 0x52},
- 205: {lang: 0x446, region: 0x98},
- 206: {lang: 0x49b, region: 0x52},
- 207: {lang: 0x9d, region: 0x13d},
- 208: {lang: 0x457, region: 0x98},
- 210: {lang: 0x51e, region: 0xb9},
- 211: {lang: 0x14e, region: 0xe6},
- 212: {lang: 0x124, region: 0xcc},
- 213: {lang: 0x461, region: 0x122},
- 214: {lang: 0xa7, region: 0x52},
- 215: {lang: 0x2c5, region: 0x98},
- 216: {lang: 0x4a3, region: 0x11b},
- 217: {lang: 0x4b4, region: 0xb3},
- 219: {lang: 0x1c7, region: 0x98},
- 221: {lang: 0x3a0, region: 0x9b},
- 222: {lang: 0x21, region: 0x9a},
- 223: {lang: 0x1e2, region: 0x52},
-}
-
-type likelyScriptRegion struct {
- region uint16
- script uint8
- flags uint8
-}
-
-// likelyLang is a lookup table, indexed by langID, for the most likely
-// scripts and regions given incomplete information. If more entries exist for a
-// given language, region and script are the index and size respectively
-// of the list in likelyLangList.
-// Size: 5276 bytes, 1319 elements
-var likelyLang = [1319]likelyScriptRegion{
- 0: {region: 0x134, script: 0x52, flags: 0x0},
- 1: {region: 0x6e, script: 0x52, flags: 0x0},
- 2: {region: 0x164, script: 0x52, flags: 0x0},
- 3: {region: 0x164, script: 0x52, flags: 0x0},
- 4: {region: 0x164, script: 0x52, flags: 0x0},
- 5: {region: 0x7c, script: 0x1e, flags: 0x0},
- 6: {region: 0x164, script: 0x52, flags: 0x0},
- 7: {region: 0x7f, script: 0x52, flags: 0x0},
- 8: {region: 0x164, script: 0x52, flags: 0x0},
- 9: {region: 0x164, script: 0x52, flags: 0x0},
- 10: {region: 0x164, script: 0x52, flags: 0x0},
- 11: {region: 0x94, script: 0x52, flags: 0x0},
- 12: {region: 0x130, script: 0x52, flags: 0x0},
- 13: {region: 0x7f, script: 0x52, flags: 0x0},
- 14: {region: 0x164, script: 0x52, flags: 0x0},
- 15: {region: 0x164, script: 0x52, flags: 0x0},
- 16: {region: 0x105, script: 0x1e, flags: 0x0},
- 17: {region: 0x164, script: 0x52, flags: 0x0},
- 18: {region: 0x9b, script: 0x9, flags: 0x0},
- 19: {region: 0x127, script: 0x5, flags: 0x0},
- 20: {region: 0x164, script: 0x52, flags: 0x0},
- 21: {region: 0x160, script: 0x52, flags: 0x0},
- 22: {region: 0x164, script: 0x52, flags: 0x0},
- 23: {region: 0x164, script: 0x52, flags: 0x0},
- 24: {region: 0x164, script: 0x52, flags: 0x0},
- 25: {region: 0x164, script: 0x52, flags: 0x0},
- 26: {region: 0x164, script: 0x52, flags: 0x0},
- 27: {region: 0x51, script: 0x52, flags: 0x0},
- 28: {region: 0x164, script: 0x52, flags: 0x0},
- 29: {region: 0x164, script: 0x52, flags: 0x0},
- 30: {region: 0x98, script: 0x4, flags: 0x0},
- 31: {region: 0x164, script: 0x52, flags: 0x0},
- 32: {region: 0x7f, script: 0x52, flags: 0x0},
- 33: {region: 0x9a, script: 0xde, flags: 0x0},
- 34: {region: 0x164, script: 0x52, flags: 0x0},
- 35: {region: 0x164, script: 0x52, flags: 0x0},
- 36: {region: 0x14c, script: 0x52, flags: 0x0},
- 37: {region: 0x105, script: 0x1e, flags: 0x0},
- 38: {region: 0x6e, script: 0x27, flags: 0x0},
- 39: {region: 0x164, script: 0x52, flags: 0x0},
- 40: {region: 0x164, script: 0x52, flags: 0x0},
- 41: {region: 0xd5, script: 0x52, flags: 0x0},
- 42: {region: 0x164, script: 0x52, flags: 0x0},
- 44: {region: 0x164, script: 0x52, flags: 0x0},
- 45: {region: 0x164, script: 0x52, flags: 0x0},
- 46: {region: 0x164, script: 0x52, flags: 0x0},
- 47: {region: 0x164, script: 0x52, flags: 0x0},
- 48: {region: 0x164, script: 0x52, flags: 0x0},
- 49: {region: 0x164, script: 0x52, flags: 0x0},
- 50: {region: 0x94, script: 0x52, flags: 0x0},
- 51: {region: 0x164, script: 0x5, flags: 0x0},
- 52: {region: 0x121, script: 0x5, flags: 0x0},
- 53: {region: 0x164, script: 0x52, flags: 0x0},
- 54: {region: 0x164, script: 0x52, flags: 0x0},
- 55: {region: 0x164, script: 0x52, flags: 0x0},
- 56: {region: 0x164, script: 0x52, flags: 0x0},
- 57: {region: 0x6a, script: 0x5, flags: 0x0},
- 58: {region: 0x0, script: 0x3, flags: 0x1},
- 59: {region: 0x164, script: 0x52, flags: 0x0},
- 60: {region: 0x50, script: 0x52, flags: 0x0},
- 61: {region: 0x3e, script: 0x52, flags: 0x0},
- 62: {region: 0x66, script: 0x5, flags: 0x0},
- 64: {region: 0xb9, script: 0x5, flags: 0x0},
- 65: {region: 0x6a, script: 0x5, flags: 0x0},
- 66: {region: 0x98, script: 0xe, flags: 0x0},
- 67: {region: 0x12e, script: 0x52, flags: 0x0},
- 68: {region: 0x134, script: 0xbc, flags: 0x0},
- 69: {region: 0x164, script: 0x52, flags: 0x0},
- 70: {region: 0x164, script: 0x52, flags: 0x0},
- 71: {region: 0x6d, script: 0x52, flags: 0x0},
- 72: {region: 0x164, script: 0x52, flags: 0x0},
- 73: {region: 0x164, script: 0x52, flags: 0x0},
- 74: {region: 0x48, script: 0x52, flags: 0x0},
- 75: {region: 0x164, script: 0x52, flags: 0x0},
- 76: {region: 0x105, script: 0x1e, flags: 0x0},
- 77: {region: 0x164, script: 0x5, flags: 0x0},
- 78: {region: 0x164, script: 0x52, flags: 0x0},
- 79: {region: 0x164, script: 0x52, flags: 0x0},
- 80: {region: 0x164, script: 0x52, flags: 0x0},
- 81: {region: 0x98, script: 0x20, flags: 0x0},
- 82: {region: 0x164, script: 0x52, flags: 0x0},
- 83: {region: 0x164, script: 0x52, flags: 0x0},
- 84: {region: 0x164, script: 0x52, flags: 0x0},
- 85: {region: 0x3e, script: 0x52, flags: 0x0},
- 86: {region: 0x164, script: 0x52, flags: 0x0},
- 87: {region: 0x3, script: 0x5, flags: 0x1},
- 88: {region: 0x105, script: 0x1e, flags: 0x0},
- 89: {region: 0xe7, script: 0x5, flags: 0x0},
- 90: {region: 0x94, script: 0x52, flags: 0x0},
- 91: {region: 0xda, script: 0x20, flags: 0x0},
- 92: {region: 0x2d, script: 0x52, flags: 0x0},
- 93: {region: 0x51, script: 0x52, flags: 0x0},
- 94: {region: 0x164, script: 0x52, flags: 0x0},
- 95: {region: 0x51, script: 0xb, flags: 0x0},
- 96: {region: 0x164, script: 0x52, flags: 0x0},
- 97: {region: 0x164, script: 0x52, flags: 0x0},
- 98: {region: 0x94, script: 0x52, flags: 0x0},
- 99: {region: 0x164, script: 0x52, flags: 0x0},
- 100: {region: 0x51, script: 0x52, flags: 0x0},
- 101: {region: 0x164, script: 0x52, flags: 0x0},
- 102: {region: 0x164, script: 0x52, flags: 0x0},
- 103: {region: 0x164, script: 0x52, flags: 0x0},
- 104: {region: 0x164, script: 0x52, flags: 0x0},
- 105: {region: 0x4e, script: 0x52, flags: 0x0},
- 106: {region: 0x164, script: 0x52, flags: 0x0},
- 107: {region: 0x164, script: 0x52, flags: 0x0},
- 108: {region: 0x164, script: 0x52, flags: 0x0},
- 109: {region: 0x164, script: 0x27, flags: 0x0},
- 110: {region: 0x164, script: 0x52, flags: 0x0},
- 111: {region: 0x164, script: 0x52, flags: 0x0},
- 112: {region: 0x46, script: 0x1e, flags: 0x0},
- 113: {region: 0x164, script: 0x52, flags: 0x0},
- 114: {region: 0x164, script: 0x52, flags: 0x0},
- 115: {region: 0x10a, script: 0x5, flags: 0x0},
- 116: {region: 0x161, script: 0x52, flags: 0x0},
- 117: {region: 0x164, script: 0x52, flags: 0x0},
- 118: {region: 0x94, script: 0x52, flags: 0x0},
- 119: {region: 0x164, script: 0x52, flags: 0x0},
- 120: {region: 0x12e, script: 0x52, flags: 0x0},
- 121: {region: 0x51, script: 0x52, flags: 0x0},
- 122: {region: 0x98, script: 0xcd, flags: 0x0},
- 123: {region: 0xe7, script: 0x5, flags: 0x0},
- 124: {region: 0x98, script: 0x20, flags: 0x0},
- 125: {region: 0x37, script: 0x1e, flags: 0x0},
- 126: {region: 0x98, script: 0x20, flags: 0x0},
- 127: {region: 0xe7, script: 0x5, flags: 0x0},
- 128: {region: 0x12a, script: 0x2d, flags: 0x0},
- 130: {region: 0x98, script: 0x20, flags: 0x0},
- 131: {region: 0x164, script: 0x52, flags: 0x0},
- 132: {region: 0x98, script: 0x20, flags: 0x0},
- 133: {region: 0xe6, script: 0x52, flags: 0x0},
- 134: {region: 0x164, script: 0x52, flags: 0x0},
- 135: {region: 0x98, script: 0x20, flags: 0x0},
- 136: {region: 0x164, script: 0x52, flags: 0x0},
- 137: {region: 0x13e, script: 0x52, flags: 0x0},
- 138: {region: 0x164, script: 0x52, flags: 0x0},
- 139: {region: 0x164, script: 0x52, flags: 0x0},
- 140: {region: 0xe6, script: 0x52, flags: 0x0},
- 141: {region: 0x164, script: 0x52, flags: 0x0},
- 142: {region: 0xd5, script: 0x52, flags: 0x0},
- 143: {region: 0x164, script: 0x52, flags: 0x0},
- 144: {region: 0x164, script: 0x52, flags: 0x0},
- 145: {region: 0x164, script: 0x52, flags: 0x0},
- 146: {region: 0x164, script: 0x27, flags: 0x0},
- 147: {region: 0x98, script: 0x20, flags: 0x0},
- 148: {region: 0x94, script: 0x52, flags: 0x0},
- 149: {region: 0x164, script: 0x52, flags: 0x0},
- 150: {region: 0x164, script: 0x52, flags: 0x0},
- 151: {region: 0x164, script: 0x52, flags: 0x0},
- 152: {region: 0x164, script: 0x52, flags: 0x0},
- 153: {region: 0x51, script: 0x52, flags: 0x0},
- 154: {region: 0x164, script: 0x52, flags: 0x0},
- 155: {region: 0xe6, script: 0x52, flags: 0x0},
- 156: {region: 0x164, script: 0x52, flags: 0x0},
- 157: {region: 0x13d, script: 0xcf, flags: 0x0},
- 158: {region: 0xc2, script: 0x52, flags: 0x0},
- 159: {region: 0x164, script: 0x52, flags: 0x0},
- 160: {region: 0x164, script: 0x52, flags: 0x0},
- 161: {region: 0xc2, script: 0x52, flags: 0x0},
- 162: {region: 0x164, script: 0x52, flags: 0x0},
- 163: {region: 0x34, script: 0xe, flags: 0x0},
- 164: {region: 0x164, script: 0x52, flags: 0x0},
- 165: {region: 0x164, script: 0x52, flags: 0x0},
- 166: {region: 0x164, script: 0x52, flags: 0x0},
- 167: {region: 0x52, script: 0xd6, flags: 0x0},
- 168: {region: 0x164, script: 0x52, flags: 0x0},
- 169: {region: 0x164, script: 0x52, flags: 0x0},
- 170: {region: 0x164, script: 0x52, flags: 0x0},
- 171: {region: 0x98, script: 0xe, flags: 0x0},
- 172: {region: 0x164, script: 0x52, flags: 0x0},
- 173: {region: 0x9b, script: 0x5, flags: 0x0},
- 174: {region: 0x164, script: 0x52, flags: 0x0},
- 175: {region: 0x4e, script: 0x52, flags: 0x0},
- 176: {region: 0x77, script: 0x52, flags: 0x0},
- 177: {region: 0x98, script: 0x20, flags: 0x0},
- 178: {region: 0xe7, script: 0x5, flags: 0x0},
- 179: {region: 0x98, script: 0x20, flags: 0x0},
- 180: {region: 0x164, script: 0x52, flags: 0x0},
- 181: {region: 0x32, script: 0x52, flags: 0x0},
- 182: {region: 0x164, script: 0x52, flags: 0x0},
- 183: {region: 0xb3, script: 0xc, flags: 0x0},
- 184: {region: 0x51, script: 0x52, flags: 0x0},
- 185: {region: 0x164, script: 0x27, flags: 0x0},
- 186: {region: 0xe6, script: 0x52, flags: 0x0},
- 187: {region: 0x164, script: 0x52, flags: 0x0},
- 188: {region: 0xe7, script: 0x20, flags: 0x0},
- 189: {region: 0x105, script: 0x1e, flags: 0x0},
- 190: {region: 0x15e, script: 0x52, flags: 0x0},
- 191: {region: 0x164, script: 0x52, flags: 0x0},
- 192: {region: 0x94, script: 0x52, flags: 0x0},
- 193: {region: 0x164, script: 0x52, flags: 0x0},
- 194: {region: 0x51, script: 0x52, flags: 0x0},
- 195: {region: 0x164, script: 0x52, flags: 0x0},
- 196: {region: 0x164, script: 0x52, flags: 0x0},
- 197: {region: 0x164, script: 0x52, flags: 0x0},
- 198: {region: 0x85, script: 0x52, flags: 0x0},
- 199: {region: 0x164, script: 0x52, flags: 0x0},
- 200: {region: 0x164, script: 0x52, flags: 0x0},
- 201: {region: 0x164, script: 0x52, flags: 0x0},
- 202: {region: 0x164, script: 0x52, flags: 0x0},
- 203: {region: 0x6c, script: 0x27, flags: 0x0},
- 204: {region: 0x164, script: 0x52, flags: 0x0},
- 205: {region: 0x164, script: 0x52, flags: 0x0},
- 206: {region: 0x51, script: 0x52, flags: 0x0},
- 207: {region: 0x164, script: 0x52, flags: 0x0},
- 208: {region: 0x164, script: 0x52, flags: 0x0},
- 209: {region: 0xc2, script: 0x52, flags: 0x0},
- 210: {region: 0x164, script: 0x52, flags: 0x0},
- 211: {region: 0x164, script: 0x52, flags: 0x0},
- 212: {region: 0x164, script: 0x52, flags: 0x0},
- 213: {region: 0x6d, script: 0x52, flags: 0x0},
- 214: {region: 0x164, script: 0x52, flags: 0x0},
- 215: {region: 0x164, script: 0x52, flags: 0x0},
- 216: {region: 0xd5, script: 0x52, flags: 0x0},
- 217: {region: 0x8, script: 0x2, flags: 0x1},
- 218: {region: 0x105, script: 0x1e, flags: 0x0},
- 219: {region: 0xe6, script: 0x52, flags: 0x0},
- 220: {region: 0x164, script: 0x52, flags: 0x0},
- 221: {region: 0x130, script: 0x52, flags: 0x0},
- 222: {region: 0x89, script: 0x52, flags: 0x0},
- 223: {region: 0x74, script: 0x52, flags: 0x0},
- 224: {region: 0x105, script: 0x1e, flags: 0x0},
- 225: {region: 0x134, script: 0x52, flags: 0x0},
- 226: {region: 0x48, script: 0x52, flags: 0x0},
- 227: {region: 0x134, script: 0x1a, flags: 0x0},
- 228: {region: 0xa5, script: 0x5, flags: 0x0},
- 229: {region: 0x13d, script: 0x19, flags: 0x0},
- 230: {region: 0x164, script: 0x52, flags: 0x0},
- 231: {region: 0x9a, script: 0x5, flags: 0x0},
- 232: {region: 0x164, script: 0x52, flags: 0x0},
- 233: {region: 0x164, script: 0x52, flags: 0x0},
- 234: {region: 0x164, script: 0x52, flags: 0x0},
- 235: {region: 0x164, script: 0x52, flags: 0x0},
- 236: {region: 0x164, script: 0x52, flags: 0x0},
- 237: {region: 0x77, script: 0x52, flags: 0x0},
- 238: {region: 0x6a, script: 0x1c, flags: 0x0},
- 239: {region: 0xe6, script: 0x52, flags: 0x0},
- 240: {region: 0x48, script: 0x17, flags: 0x0},
- 241: {region: 0x48, script: 0x17, flags: 0x0},
- 242: {region: 0x48, script: 0x17, flags: 0x0},
- 243: {region: 0x48, script: 0x17, flags: 0x0},
- 244: {region: 0x48, script: 0x17, flags: 0x0},
- 245: {region: 0x109, script: 0x52, flags: 0x0},
- 246: {region: 0x5d, script: 0x52, flags: 0x0},
- 247: {region: 0xe8, script: 0x52, flags: 0x0},
- 248: {region: 0x48, script: 0x17, flags: 0x0},
- 249: {region: 0xc3, script: 0x79, flags: 0x0},
- 250: {region: 0xa, script: 0x2, flags: 0x1},
- 251: {region: 0x105, script: 0x1e, flags: 0x0},
- 252: {region: 0x7a, script: 0x52, flags: 0x0},
- 253: {region: 0x62, script: 0x52, flags: 0x0},
- 254: {region: 0x164, script: 0x52, flags: 0x0},
- 255: {region: 0x164, script: 0x52, flags: 0x0},
- 256: {region: 0x164, script: 0x52, flags: 0x0},
- 257: {region: 0x164, script: 0x52, flags: 0x0},
- 258: {region: 0x134, script: 0x52, flags: 0x0},
- 259: {region: 0x105, script: 0x1e, flags: 0x0},
- 260: {region: 0xa3, script: 0x52, flags: 0x0},
- 261: {region: 0x164, script: 0x52, flags: 0x0},
- 262: {region: 0x164, script: 0x52, flags: 0x0},
- 263: {region: 0x98, script: 0x5, flags: 0x0},
- 264: {region: 0x164, script: 0x52, flags: 0x0},
- 265: {region: 0x5f, script: 0x52, flags: 0x0},
- 266: {region: 0x164, script: 0x52, flags: 0x0},
- 267: {region: 0x48, script: 0x52, flags: 0x0},
- 268: {region: 0x164, script: 0x52, flags: 0x0},
- 269: {region: 0x164, script: 0x52, flags: 0x0},
- 270: {region: 0x164, script: 0x52, flags: 0x0},
- 271: {region: 0x164, script: 0x5, flags: 0x0},
- 272: {region: 0x48, script: 0x52, flags: 0x0},
- 273: {region: 0x164, script: 0x52, flags: 0x0},
- 274: {region: 0x164, script: 0x52, flags: 0x0},
- 275: {region: 0xd3, script: 0x52, flags: 0x0},
- 276: {region: 0x4e, script: 0x52, flags: 0x0},
- 277: {region: 0x164, script: 0x52, flags: 0x0},
- 278: {region: 0x98, script: 0x5, flags: 0x0},
- 279: {region: 0x164, script: 0x52, flags: 0x0},
- 280: {region: 0x164, script: 0x52, flags: 0x0},
- 281: {region: 0x164, script: 0x52, flags: 0x0},
- 282: {region: 0x164, script: 0x27, flags: 0x0},
- 283: {region: 0x5f, script: 0x52, flags: 0x0},
- 284: {region: 0xc2, script: 0x52, flags: 0x0},
- 285: {region: 0xcf, script: 0x52, flags: 0x0},
- 286: {region: 0x164, script: 0x52, flags: 0x0},
- 287: {region: 0xda, script: 0x20, flags: 0x0},
- 288: {region: 0x51, script: 0x52, flags: 0x0},
- 289: {region: 0x164, script: 0x52, flags: 0x0},
- 290: {region: 0x164, script: 0x52, flags: 0x0},
- 291: {region: 0x164, script: 0x52, flags: 0x0},
- 292: {region: 0xcc, script: 0xd4, flags: 0x0},
- 293: {region: 0x164, script: 0x52, flags: 0x0},
- 294: {region: 0x164, script: 0x52, flags: 0x0},
- 295: {region: 0x113, script: 0x52, flags: 0x0},
- 296: {region: 0x36, script: 0x52, flags: 0x0},
- 297: {region: 0x42, script: 0xd6, flags: 0x0},
- 298: {region: 0x164, script: 0x52, flags: 0x0},
- 299: {region: 0xa3, script: 0x52, flags: 0x0},
- 300: {region: 0x7f, script: 0x52, flags: 0x0},
- 301: {region: 0xd5, script: 0x52, flags: 0x0},
- 302: {region: 0x9d, script: 0x52, flags: 0x0},
- 303: {region: 0x6a, script: 0x25, flags: 0x0},
- 304: {region: 0xc3, script: 0x43, flags: 0x0},
- 305: {region: 0x86, script: 0x2d, flags: 0x0},
- 306: {region: 0x164, script: 0x52, flags: 0x0},
- 307: {region: 0x164, script: 0x52, flags: 0x0},
- 308: {region: 0xc, script: 0x2, flags: 0x1},
- 309: {region: 0x164, script: 0x52, flags: 0x0},
- 310: {region: 0x164, script: 0x52, flags: 0x0},
- 311: {region: 0x1, script: 0x52, flags: 0x0},
- 312: {region: 0x164, script: 0x52, flags: 0x0},
- 313: {region: 0x6d, script: 0x52, flags: 0x0},
- 314: {region: 0x134, script: 0x52, flags: 0x0},
- 315: {region: 0x69, script: 0x52, flags: 0x0},
- 316: {region: 0x164, script: 0x52, flags: 0x0},
- 317: {region: 0x9d, script: 0x3e, flags: 0x0},
- 318: {region: 0x164, script: 0x52, flags: 0x0},
- 319: {region: 0x164, script: 0x52, flags: 0x0},
- 320: {region: 0x6d, script: 0x52, flags: 0x0},
- 321: {region: 0x51, script: 0x52, flags: 0x0},
- 322: {region: 0x6d, script: 0x52, flags: 0x0},
- 323: {region: 0x9b, script: 0x5, flags: 0x0},
- 324: {region: 0x164, script: 0x52, flags: 0x0},
- 325: {region: 0x164, script: 0x52, flags: 0x0},
- 326: {region: 0x164, script: 0x52, flags: 0x0},
- 327: {region: 0x164, script: 0x52, flags: 0x0},
- 328: {region: 0x85, script: 0x52, flags: 0x0},
- 329: {region: 0xe, script: 0x2, flags: 0x1},
- 330: {region: 0x164, script: 0x52, flags: 0x0},
- 331: {region: 0xc2, script: 0x52, flags: 0x0},
- 332: {region: 0x71, script: 0x52, flags: 0x0},
- 333: {region: 0x10a, script: 0x5, flags: 0x0},
- 334: {region: 0xe6, script: 0x52, flags: 0x0},
- 335: {region: 0x10b, script: 0x52, flags: 0x0},
- 336: {region: 0x72, script: 0x52, flags: 0x0},
- 337: {region: 0x164, script: 0x52, flags: 0x0},
- 338: {region: 0x164, script: 0x52, flags: 0x0},
- 339: {region: 0x75, script: 0x52, flags: 0x0},
- 340: {region: 0x164, script: 0x52, flags: 0x0},
- 341: {region: 0x3a, script: 0x52, flags: 0x0},
- 342: {region: 0x164, script: 0x52, flags: 0x0},
- 343: {region: 0x164, script: 0x52, flags: 0x0},
- 344: {region: 0x164, script: 0x52, flags: 0x0},
- 345: {region: 0x77, script: 0x52, flags: 0x0},
- 346: {region: 0x134, script: 0x52, flags: 0x0},
- 347: {region: 0x77, script: 0x52, flags: 0x0},
- 348: {region: 0x5f, script: 0x52, flags: 0x0},
- 349: {region: 0x5f, script: 0x52, flags: 0x0},
- 350: {region: 0x51, script: 0x5, flags: 0x0},
- 351: {region: 0x13f, script: 0x52, flags: 0x0},
- 352: {region: 0x164, script: 0x52, flags: 0x0},
- 353: {region: 0x83, script: 0x52, flags: 0x0},
- 354: {region: 0x164, script: 0x52, flags: 0x0},
- 355: {region: 0xd3, script: 0x52, flags: 0x0},
- 356: {region: 0x9d, script: 0x52, flags: 0x0},
- 357: {region: 0xd5, script: 0x52, flags: 0x0},
- 358: {region: 0x164, script: 0x52, flags: 0x0},
- 359: {region: 0x10a, script: 0x52, flags: 0x0},
- 360: {region: 0xd8, script: 0x52, flags: 0x0},
- 361: {region: 0x95, script: 0x52, flags: 0x0},
- 362: {region: 0x7f, script: 0x52, flags: 0x0},
- 363: {region: 0x164, script: 0x52, flags: 0x0},
- 364: {region: 0xbb, script: 0x52, flags: 0x0},
- 365: {region: 0x164, script: 0x52, flags: 0x0},
- 366: {region: 0x164, script: 0x52, flags: 0x0},
- 367: {region: 0x164, script: 0x52, flags: 0x0},
- 368: {region: 0x52, script: 0x34, flags: 0x0},
- 369: {region: 0x164, script: 0x52, flags: 0x0},
- 370: {region: 0x94, script: 0x52, flags: 0x0},
- 371: {region: 0x164, script: 0x52, flags: 0x0},
- 372: {region: 0x98, script: 0x20, flags: 0x0},
- 373: {region: 0x164, script: 0x52, flags: 0x0},
- 374: {region: 0x9b, script: 0x5, flags: 0x0},
- 375: {region: 0x7d, script: 0x52, flags: 0x0},
- 376: {region: 0x7a, script: 0x52, flags: 0x0},
- 377: {region: 0x164, script: 0x52, flags: 0x0},
- 378: {region: 0x164, script: 0x52, flags: 0x0},
- 379: {region: 0x164, script: 0x52, flags: 0x0},
- 380: {region: 0x164, script: 0x52, flags: 0x0},
- 381: {region: 0x164, script: 0x52, flags: 0x0},
- 382: {region: 0x164, script: 0x52, flags: 0x0},
- 383: {region: 0x6e, script: 0x27, flags: 0x0},
- 384: {region: 0x164, script: 0x52, flags: 0x0},
- 385: {region: 0xda, script: 0x20, flags: 0x0},
- 386: {region: 0x164, script: 0x52, flags: 0x0},
- 387: {region: 0xa6, script: 0x52, flags: 0x0},
- 388: {region: 0x164, script: 0x52, flags: 0x0},
- 389: {region: 0xe7, script: 0x5, flags: 0x0},
- 390: {region: 0x164, script: 0x52, flags: 0x0},
- 391: {region: 0xe7, script: 0x5, flags: 0x0},
- 392: {region: 0x164, script: 0x52, flags: 0x0},
- 393: {region: 0x164, script: 0x52, flags: 0x0},
- 394: {region: 0x6d, script: 0x52, flags: 0x0},
- 395: {region: 0x9b, script: 0x5, flags: 0x0},
- 396: {region: 0x164, script: 0x52, flags: 0x0},
- 397: {region: 0x164, script: 0x27, flags: 0x0},
- 398: {region: 0xf0, script: 0x52, flags: 0x0},
- 399: {region: 0x164, script: 0x52, flags: 0x0},
- 400: {region: 0x164, script: 0x52, flags: 0x0},
- 401: {region: 0x164, script: 0x52, flags: 0x0},
- 402: {region: 0x164, script: 0x27, flags: 0x0},
- 403: {region: 0x164, script: 0x52, flags: 0x0},
- 404: {region: 0x98, script: 0x20, flags: 0x0},
- 405: {region: 0x98, script: 0xd0, flags: 0x0},
- 406: {region: 0x94, script: 0x52, flags: 0x0},
- 407: {region: 0xd8, script: 0x52, flags: 0x0},
- 408: {region: 0x12f, script: 0x2b, flags: 0x0},
- 409: {region: 0x10, script: 0x2, flags: 0x1},
- 410: {region: 0x98, script: 0xe, flags: 0x0},
- 411: {region: 0x164, script: 0x52, flags: 0x0},
- 412: {region: 0x4d, script: 0x52, flags: 0x0},
- 413: {region: 0x98, script: 0x2e, flags: 0x0},
- 414: {region: 0x40, script: 0x52, flags: 0x0},
- 415: {region: 0x53, script: 0x52, flags: 0x0},
- 416: {region: 0x164, script: 0x52, flags: 0x0},
- 417: {region: 0x7f, script: 0x52, flags: 0x0},
- 418: {region: 0x164, script: 0x52, flags: 0x0},
- 419: {region: 0x164, script: 0x52, flags: 0x0},
- 420: {region: 0xa3, script: 0x52, flags: 0x0},
- 421: {region: 0x97, script: 0x52, flags: 0x0},
- 422: {region: 0x164, script: 0x52, flags: 0x0},
- 423: {region: 0xda, script: 0x20, flags: 0x0},
- 424: {region: 0x164, script: 0x52, flags: 0x0},
- 425: {region: 0x164, script: 0x5, flags: 0x0},
- 426: {region: 0x48, script: 0x52, flags: 0x0},
- 427: {region: 0x164, script: 0x5, flags: 0x0},
- 428: {region: 0x164, script: 0x52, flags: 0x0},
- 429: {region: 0x12, script: 0x3, flags: 0x1},
- 430: {region: 0x164, script: 0x52, flags: 0x0},
- 431: {region: 0x52, script: 0x34, flags: 0x0},
- 432: {region: 0x164, script: 0x52, flags: 0x0},
- 433: {region: 0x134, script: 0x52, flags: 0x0},
- 434: {region: 0x23, script: 0x5, flags: 0x0},
- 435: {region: 0x164, script: 0x52, flags: 0x0},
- 436: {region: 0x164, script: 0x27, flags: 0x0},
- 437: {region: 0x96, script: 0x37, flags: 0x0},
- 438: {region: 0x164, script: 0x52, flags: 0x0},
- 439: {region: 0x98, script: 0x20, flags: 0x0},
- 440: {region: 0x164, script: 0x52, flags: 0x0},
- 441: {region: 0x72, script: 0x52, flags: 0x0},
- 442: {region: 0x164, script: 0x52, flags: 0x0},
- 443: {region: 0x164, script: 0x52, flags: 0x0},
- 444: {region: 0xe6, script: 0x52, flags: 0x0},
- 445: {region: 0x164, script: 0x52, flags: 0x0},
- 446: {region: 0x12a, script: 0x39, flags: 0x0},
- 447: {region: 0x52, script: 0x81, flags: 0x0},
- 448: {region: 0x164, script: 0x52, flags: 0x0},
- 449: {region: 0xe7, script: 0x5, flags: 0x0},
- 450: {region: 0x98, script: 0x20, flags: 0x0},
- 451: {region: 0xae, script: 0x3a, flags: 0x0},
- 452: {region: 0xe6, script: 0x52, flags: 0x0},
- 453: {region: 0xe7, script: 0x5, flags: 0x0},
- 454: {region: 0xe5, script: 0x52, flags: 0x0},
- 455: {region: 0x98, script: 0x20, flags: 0x0},
- 456: {region: 0x98, script: 0x20, flags: 0x0},
- 457: {region: 0x164, script: 0x52, flags: 0x0},
- 458: {region: 0x8f, script: 0x52, flags: 0x0},
- 459: {region: 0x5f, script: 0x52, flags: 0x0},
- 460: {region: 0x52, script: 0x34, flags: 0x0},
- 461: {region: 0x90, script: 0x52, flags: 0x0},
- 462: {region: 0x91, script: 0x52, flags: 0x0},
- 463: {region: 0x164, script: 0x52, flags: 0x0},
- 464: {region: 0x27, script: 0x8, flags: 0x0},
- 465: {region: 0xd1, script: 0x52, flags: 0x0},
- 466: {region: 0x77, script: 0x52, flags: 0x0},
- 467: {region: 0x164, script: 0x52, flags: 0x0},
- 468: {region: 0x164, script: 0x52, flags: 0x0},
- 469: {region: 0xcf, script: 0x52, flags: 0x0},
- 470: {region: 0xd5, script: 0x52, flags: 0x0},
- 471: {region: 0x164, script: 0x52, flags: 0x0},
- 472: {region: 0x164, script: 0x52, flags: 0x0},
- 473: {region: 0x164, script: 0x52, flags: 0x0},
- 474: {region: 0x94, script: 0x52, flags: 0x0},
- 475: {region: 0x164, script: 0x52, flags: 0x0},
- 476: {region: 0x164, script: 0x52, flags: 0x0},
- 477: {region: 0x164, script: 0x52, flags: 0x0},
- 479: {region: 0xd5, script: 0x52, flags: 0x0},
- 480: {region: 0x164, script: 0x52, flags: 0x0},
- 481: {region: 0x164, script: 0x52, flags: 0x0},
- 482: {region: 0x52, script: 0xdf, flags: 0x0},
- 483: {region: 0x164, script: 0x52, flags: 0x0},
- 484: {region: 0x134, script: 0x52, flags: 0x0},
- 485: {region: 0x164, script: 0x52, flags: 0x0},
- 486: {region: 0x48, script: 0x52, flags: 0x0},
- 487: {region: 0x164, script: 0x52, flags: 0x0},
- 488: {region: 0x164, script: 0x52, flags: 0x0},
- 489: {region: 0xe6, script: 0x52, flags: 0x0},
- 490: {region: 0x164, script: 0x52, flags: 0x0},
- 491: {region: 0x94, script: 0x52, flags: 0x0},
- 492: {region: 0x105, script: 0x1e, flags: 0x0},
- 494: {region: 0x164, script: 0x52, flags: 0x0},
- 495: {region: 0x164, script: 0x52, flags: 0x0},
- 496: {region: 0x9c, script: 0x52, flags: 0x0},
- 497: {region: 0x9d, script: 0x52, flags: 0x0},
- 498: {region: 0x48, script: 0x17, flags: 0x0},
- 499: {region: 0x96, script: 0x37, flags: 0x0},
- 500: {region: 0x164, script: 0x52, flags: 0x0},
- 501: {region: 0x164, script: 0x52, flags: 0x0},
- 502: {region: 0x105, script: 0x52, flags: 0x0},
- 503: {region: 0x164, script: 0x52, flags: 0x0},
- 504: {region: 0xa1, script: 0x41, flags: 0x0},
- 505: {region: 0x164, script: 0x52, flags: 0x0},
- 506: {region: 0x9f, script: 0x52, flags: 0x0},
- 508: {region: 0x164, script: 0x52, flags: 0x0},
- 509: {region: 0x164, script: 0x52, flags: 0x0},
- 510: {region: 0x164, script: 0x52, flags: 0x0},
- 511: {region: 0x51, script: 0x52, flags: 0x0},
- 512: {region: 0x12f, script: 0x37, flags: 0x0},
- 513: {region: 0x164, script: 0x52, flags: 0x0},
- 514: {region: 0x12e, script: 0x52, flags: 0x0},
- 515: {region: 0xda, script: 0x20, flags: 0x0},
- 516: {region: 0x164, script: 0x52, flags: 0x0},
- 517: {region: 0x62, script: 0x52, flags: 0x0},
- 518: {region: 0x94, script: 0x52, flags: 0x0},
- 519: {region: 0x94, script: 0x52, flags: 0x0},
- 520: {region: 0x7c, script: 0x29, flags: 0x0},
- 521: {region: 0x136, script: 0x1e, flags: 0x0},
- 522: {region: 0x66, script: 0x52, flags: 0x0},
- 523: {region: 0xc3, script: 0x52, flags: 0x0},
- 524: {region: 0x164, script: 0x52, flags: 0x0},
- 525: {region: 0x164, script: 0x52, flags: 0x0},
- 526: {region: 0xd5, script: 0x52, flags: 0x0},
- 527: {region: 0xa3, script: 0x52, flags: 0x0},
- 528: {region: 0xc2, script: 0x52, flags: 0x0},
- 529: {region: 0x105, script: 0x1e, flags: 0x0},
- 530: {region: 0x164, script: 0x52, flags: 0x0},
- 531: {region: 0x164, script: 0x52, flags: 0x0},
- 532: {region: 0x164, script: 0x52, flags: 0x0},
- 533: {region: 0x164, script: 0x52, flags: 0x0},
- 534: {region: 0xd3, script: 0x5, flags: 0x0},
- 535: {region: 0xd5, script: 0x52, flags: 0x0},
- 536: {region: 0x163, script: 0x52, flags: 0x0},
- 537: {region: 0x164, script: 0x52, flags: 0x0},
- 538: {region: 0x164, script: 0x52, flags: 0x0},
- 539: {region: 0x12e, script: 0x52, flags: 0x0},
- 540: {region: 0x121, script: 0x5, flags: 0x0},
- 541: {region: 0x164, script: 0x52, flags: 0x0},
- 542: {region: 0x122, script: 0xd5, flags: 0x0},
- 543: {region: 0x59, script: 0x52, flags: 0x0},
- 544: {region: 0x51, script: 0x52, flags: 0x0},
- 545: {region: 0x164, script: 0x52, flags: 0x0},
- 546: {region: 0x4e, script: 0x52, flags: 0x0},
- 547: {region: 0x98, script: 0x20, flags: 0x0},
- 548: {region: 0x98, script: 0x20, flags: 0x0},
- 549: {region: 0x4a, script: 0x52, flags: 0x0},
- 550: {region: 0x94, script: 0x52, flags: 0x0},
- 551: {region: 0x164, script: 0x52, flags: 0x0},
- 552: {region: 0x40, script: 0x52, flags: 0x0},
- 553: {region: 0x98, script: 0x52, flags: 0x0},
- 554: {region: 0x52, script: 0xcc, flags: 0x0},
- 555: {region: 0x98, script: 0x20, flags: 0x0},
- 556: {region: 0xc2, script: 0x52, flags: 0x0},
- 557: {region: 0x164, script: 0x52, flags: 0x0},
- 558: {region: 0x98, script: 0x6b, flags: 0x0},
- 559: {region: 0xe7, script: 0x5, flags: 0x0},
- 560: {region: 0x164, script: 0x52, flags: 0x0},
- 561: {region: 0xa3, script: 0x52, flags: 0x0},
- 562: {region: 0x164, script: 0x52, flags: 0x0},
- 563: {region: 0x12a, script: 0x52, flags: 0x0},
- 564: {region: 0x164, script: 0x52, flags: 0x0},
- 565: {region: 0xd1, script: 0x52, flags: 0x0},
- 566: {region: 0x164, script: 0x52, flags: 0x0},
- 567: {region: 0xae, script: 0x4f, flags: 0x0},
- 568: {region: 0x164, script: 0x52, flags: 0x0},
- 569: {region: 0x164, script: 0x52, flags: 0x0},
- 570: {region: 0x15, script: 0x6, flags: 0x1},
- 571: {region: 0x164, script: 0x52, flags: 0x0},
- 572: {region: 0x51, script: 0x52, flags: 0x0},
- 573: {region: 0x81, script: 0x52, flags: 0x0},
- 574: {region: 0xa3, script: 0x52, flags: 0x0},
- 575: {region: 0x164, script: 0x52, flags: 0x0},
- 576: {region: 0x164, script: 0x52, flags: 0x0},
- 577: {region: 0x164, script: 0x52, flags: 0x0},
- 578: {region: 0xa5, script: 0x46, flags: 0x0},
- 579: {region: 0x29, script: 0x52, flags: 0x0},
- 580: {region: 0x164, script: 0x52, flags: 0x0},
- 581: {region: 0x164, script: 0x52, flags: 0x0},
- 582: {region: 0x164, script: 0x52, flags: 0x0},
- 583: {region: 0x164, script: 0x52, flags: 0x0},
- 584: {region: 0x164, script: 0x52, flags: 0x0},
- 585: {region: 0x98, script: 0x4a, flags: 0x0},
- 586: {region: 0x164, script: 0x52, flags: 0x0},
- 587: {region: 0xaa, script: 0x4b, flags: 0x0},
- 588: {region: 0x105, script: 0x1e, flags: 0x0},
- 589: {region: 0x98, script: 0x20, flags: 0x0},
- 590: {region: 0x164, script: 0x52, flags: 0x0},
- 591: {region: 0x74, script: 0x52, flags: 0x0},
- 592: {region: 0x164, script: 0x52, flags: 0x0},
- 593: {region: 0xb3, script: 0x52, flags: 0x0},
- 594: {region: 0x164, script: 0x52, flags: 0x0},
- 595: {region: 0x164, script: 0x52, flags: 0x0},
- 596: {region: 0x164, script: 0x52, flags: 0x0},
- 597: {region: 0x164, script: 0x52, flags: 0x0},
- 598: {region: 0x164, script: 0x52, flags: 0x0},
- 599: {region: 0x164, script: 0x52, flags: 0x0},
- 600: {region: 0x164, script: 0x52, flags: 0x0},
- 601: {region: 0x164, script: 0x27, flags: 0x0},
- 603: {region: 0x105, script: 0x1e, flags: 0x0},
- 604: {region: 0x111, script: 0x52, flags: 0x0},
- 605: {region: 0xe6, script: 0x52, flags: 0x0},
- 606: {region: 0x105, script: 0x52, flags: 0x0},
- 607: {region: 0x164, script: 0x52, flags: 0x0},
- 608: {region: 0x98, script: 0x20, flags: 0x0},
- 609: {region: 0x98, script: 0x5, flags: 0x0},
- 610: {region: 0x12e, script: 0x52, flags: 0x0},
- 611: {region: 0x164, script: 0x52, flags: 0x0},
- 612: {region: 0x51, script: 0x52, flags: 0x0},
- 613: {region: 0x5f, script: 0x52, flags: 0x0},
- 614: {region: 0x164, script: 0x52, flags: 0x0},
- 615: {region: 0x164, script: 0x52, flags: 0x0},
- 616: {region: 0x164, script: 0x27, flags: 0x0},
- 617: {region: 0x164, script: 0x52, flags: 0x0},
- 618: {region: 0x164, script: 0x52, flags: 0x0},
- 619: {region: 0x1b, script: 0x3, flags: 0x1},
- 620: {region: 0x164, script: 0x52, flags: 0x0},
- 621: {region: 0x164, script: 0x52, flags: 0x0},
- 622: {region: 0x164, script: 0x52, flags: 0x0},
- 623: {region: 0x164, script: 0x52, flags: 0x0},
- 624: {region: 0x105, script: 0x1e, flags: 0x0},
- 625: {region: 0x164, script: 0x52, flags: 0x0},
- 626: {region: 0x164, script: 0x52, flags: 0x0},
- 627: {region: 0x164, script: 0x52, flags: 0x0},
- 628: {region: 0x105, script: 0x1e, flags: 0x0},
- 629: {region: 0x164, script: 0x52, flags: 0x0},
- 630: {region: 0x94, script: 0x52, flags: 0x0},
- 631: {region: 0xe7, script: 0x5, flags: 0x0},
- 632: {region: 0x7a, script: 0x52, flags: 0x0},
- 633: {region: 0x164, script: 0x52, flags: 0x0},
- 634: {region: 0x164, script: 0x52, flags: 0x0},
- 635: {region: 0x164, script: 0x52, flags: 0x0},
- 636: {region: 0x164, script: 0x27, flags: 0x0},
- 637: {region: 0x122, script: 0xd5, flags: 0x0},
- 638: {region: 0xe7, script: 0x5, flags: 0x0},
- 639: {region: 0x164, script: 0x52, flags: 0x0},
- 640: {region: 0x164, script: 0x52, flags: 0x0},
- 641: {region: 0x1e, script: 0x5, flags: 0x1},
- 642: {region: 0x164, script: 0x52, flags: 0x0},
- 643: {region: 0x164, script: 0x52, flags: 0x0},
- 644: {region: 0x164, script: 0x52, flags: 0x0},
- 645: {region: 0x137, script: 0x52, flags: 0x0},
- 646: {region: 0x86, script: 0x56, flags: 0x0},
- 647: {region: 0x96, script: 0x37, flags: 0x0},
- 648: {region: 0x12e, script: 0x52, flags: 0x0},
- 649: {region: 0xe7, script: 0x5, flags: 0x0},
- 650: {region: 0x130, script: 0x52, flags: 0x0},
- 651: {region: 0x164, script: 0x52, flags: 0x0},
- 652: {region: 0xb6, script: 0x52, flags: 0x0},
- 653: {region: 0x105, script: 0x1e, flags: 0x0},
- 654: {region: 0x164, script: 0x52, flags: 0x0},
- 655: {region: 0x94, script: 0x52, flags: 0x0},
- 656: {region: 0x164, script: 0x52, flags: 0x0},
- 657: {region: 0x52, script: 0xd5, flags: 0x0},
- 658: {region: 0x164, script: 0x52, flags: 0x0},
- 659: {region: 0x164, script: 0x52, flags: 0x0},
- 660: {region: 0x164, script: 0x52, flags: 0x0},
- 661: {region: 0x164, script: 0x52, flags: 0x0},
- 662: {region: 0x98, script: 0x54, flags: 0x0},
- 663: {region: 0x164, script: 0x52, flags: 0x0},
- 664: {region: 0x164, script: 0x52, flags: 0x0},
- 665: {region: 0x105, script: 0x1e, flags: 0x0},
- 666: {region: 0x130, script: 0x52, flags: 0x0},
- 667: {region: 0x164, script: 0x52, flags: 0x0},
- 668: {region: 0xd8, script: 0x52, flags: 0x0},
- 669: {region: 0x164, script: 0x52, flags: 0x0},
- 670: {region: 0x164, script: 0x52, flags: 0x0},
- 671: {region: 0x23, script: 0x2, flags: 0x1},
- 672: {region: 0x164, script: 0x52, flags: 0x0},
- 673: {region: 0x164, script: 0x52, flags: 0x0},
- 674: {region: 0x9d, script: 0x52, flags: 0x0},
- 675: {region: 0x52, script: 0x58, flags: 0x0},
- 676: {region: 0x94, script: 0x52, flags: 0x0},
- 677: {region: 0x9b, script: 0x5, flags: 0x0},
- 678: {region: 0x134, script: 0x52, flags: 0x0},
- 679: {region: 0x164, script: 0x52, flags: 0x0},
- 680: {region: 0x164, script: 0x52, flags: 0x0},
- 681: {region: 0x98, script: 0xd0, flags: 0x0},
- 682: {region: 0x9d, script: 0x52, flags: 0x0},
- 683: {region: 0x164, script: 0x52, flags: 0x0},
- 684: {region: 0x4a, script: 0x52, flags: 0x0},
- 685: {region: 0x164, script: 0x52, flags: 0x0},
- 686: {region: 0x164, script: 0x52, flags: 0x0},
- 687: {region: 0xae, script: 0x4f, flags: 0x0},
- 688: {region: 0x164, script: 0x52, flags: 0x0},
- 689: {region: 0x164, script: 0x52, flags: 0x0},
- 690: {region: 0x4a, script: 0x52, flags: 0x0},
- 691: {region: 0x164, script: 0x52, flags: 0x0},
- 692: {region: 0x164, script: 0x52, flags: 0x0},
- 693: {region: 0x161, script: 0x52, flags: 0x0},
- 694: {region: 0x9b, script: 0x5, flags: 0x0},
- 695: {region: 0xb5, script: 0x52, flags: 0x0},
- 696: {region: 0xb7, script: 0x52, flags: 0x0},
- 697: {region: 0x4a, script: 0x52, flags: 0x0},
- 698: {region: 0x4a, script: 0x52, flags: 0x0},
- 699: {region: 0xa3, script: 0x52, flags: 0x0},
- 700: {region: 0xa3, script: 0x52, flags: 0x0},
- 701: {region: 0x9b, script: 0x5, flags: 0x0},
- 702: {region: 0xb7, script: 0x52, flags: 0x0},
- 703: {region: 0x122, script: 0xd5, flags: 0x0},
- 704: {region: 0x52, script: 0x34, flags: 0x0},
- 705: {region: 0x12a, script: 0x52, flags: 0x0},
- 706: {region: 0x94, script: 0x52, flags: 0x0},
- 707: {region: 0x51, script: 0x52, flags: 0x0},
- 708: {region: 0x98, script: 0x20, flags: 0x0},
- 709: {region: 0x98, script: 0x20, flags: 0x0},
- 710: {region: 0x94, script: 0x52, flags: 0x0},
- 711: {region: 0x25, script: 0x3, flags: 0x1},
- 712: {region: 0xa3, script: 0x52, flags: 0x0},
- 713: {region: 0x164, script: 0x52, flags: 0x0},
- 714: {region: 0xce, script: 0x52, flags: 0x0},
- 715: {region: 0x164, script: 0x52, flags: 0x0},
- 716: {region: 0x164, script: 0x52, flags: 0x0},
- 717: {region: 0x164, script: 0x52, flags: 0x0},
- 718: {region: 0x164, script: 0x52, flags: 0x0},
- 719: {region: 0x164, script: 0x52, flags: 0x0},
- 720: {region: 0x164, script: 0x52, flags: 0x0},
- 721: {region: 0x164, script: 0x52, flags: 0x0},
- 722: {region: 0x164, script: 0x52, flags: 0x0},
- 723: {region: 0x164, script: 0x52, flags: 0x0},
- 724: {region: 0x164, script: 0x52, flags: 0x0},
- 725: {region: 0x164, script: 0x52, flags: 0x0},
- 726: {region: 0x164, script: 0x5, flags: 0x0},
- 727: {region: 0x105, script: 0x1e, flags: 0x0},
- 728: {region: 0xe6, script: 0x52, flags: 0x0},
- 729: {region: 0x164, script: 0x52, flags: 0x0},
- 730: {region: 0x94, script: 0x52, flags: 0x0},
- 731: {region: 0x164, script: 0x27, flags: 0x0},
- 732: {region: 0x164, script: 0x52, flags: 0x0},
- 733: {region: 0x164, script: 0x52, flags: 0x0},
- 734: {region: 0x164, script: 0x52, flags: 0x0},
- 735: {region: 0x111, script: 0x52, flags: 0x0},
- 736: {region: 0xa3, script: 0x52, flags: 0x0},
- 737: {region: 0x164, script: 0x52, flags: 0x0},
- 738: {region: 0x164, script: 0x52, flags: 0x0},
- 739: {region: 0x122, script: 0x5, flags: 0x0},
- 740: {region: 0xcb, script: 0x52, flags: 0x0},
- 741: {region: 0x164, script: 0x52, flags: 0x0},
- 742: {region: 0x164, script: 0x52, flags: 0x0},
- 743: {region: 0x164, script: 0x52, flags: 0x0},
- 744: {region: 0xbe, script: 0x52, flags: 0x0},
- 745: {region: 0xd0, script: 0x52, flags: 0x0},
- 746: {region: 0x164, script: 0x52, flags: 0x0},
- 747: {region: 0x51, script: 0x52, flags: 0x0},
- 748: {region: 0xda, script: 0x20, flags: 0x0},
- 749: {region: 0x12e, script: 0x52, flags: 0x0},
- 750: {region: 0xbf, script: 0x52, flags: 0x0},
- 751: {region: 0x164, script: 0x52, flags: 0x0},
- 752: {region: 0x164, script: 0x52, flags: 0x0},
- 753: {region: 0xdf, script: 0x52, flags: 0x0},
- 754: {region: 0x164, script: 0x52, flags: 0x0},
- 755: {region: 0x94, script: 0x52, flags: 0x0},
- 756: {region: 0x9a, script: 0x36, flags: 0x0},
- 757: {region: 0x164, script: 0x52, flags: 0x0},
- 758: {region: 0xc1, script: 0x1e, flags: 0x0},
- 759: {region: 0x164, script: 0x5, flags: 0x0},
- 760: {region: 0x164, script: 0x52, flags: 0x0},
- 761: {region: 0x164, script: 0x52, flags: 0x0},
- 762: {region: 0x164, script: 0x52, flags: 0x0},
- 763: {region: 0x98, script: 0x64, flags: 0x0},
- 764: {region: 0x164, script: 0x52, flags: 0x0},
- 765: {region: 0x164, script: 0x52, flags: 0x0},
- 766: {region: 0x10a, script: 0x52, flags: 0x0},
- 767: {region: 0x164, script: 0x52, flags: 0x0},
- 768: {region: 0x164, script: 0x52, flags: 0x0},
- 769: {region: 0x164, script: 0x52, flags: 0x0},
- 770: {region: 0x28, script: 0x3, flags: 0x1},
- 771: {region: 0x164, script: 0x52, flags: 0x0},
- 772: {region: 0x164, script: 0x52, flags: 0x0},
- 773: {region: 0x98, script: 0xe, flags: 0x0},
- 774: {region: 0xc3, script: 0x6b, flags: 0x0},
- 776: {region: 0x164, script: 0x52, flags: 0x0},
- 777: {region: 0x48, script: 0x52, flags: 0x0},
- 778: {region: 0x48, script: 0x52, flags: 0x0},
- 779: {region: 0x36, script: 0x52, flags: 0x0},
- 780: {region: 0x164, script: 0x52, flags: 0x0},
- 781: {region: 0x164, script: 0x52, flags: 0x0},
- 782: {region: 0x164, script: 0x52, flags: 0x0},
- 783: {region: 0x164, script: 0x52, flags: 0x0},
- 784: {region: 0x164, script: 0x52, flags: 0x0},
- 785: {region: 0x164, script: 0x52, flags: 0x0},
- 786: {region: 0x98, script: 0x20, flags: 0x0},
- 787: {region: 0xda, script: 0x20, flags: 0x0},
- 788: {region: 0x105, script: 0x1e, flags: 0x0},
- 789: {region: 0x34, script: 0x68, flags: 0x0},
- 790: {region: 0x2b, script: 0x3, flags: 0x1},
- 791: {region: 0xca, script: 0x52, flags: 0x0},
- 792: {region: 0x164, script: 0x52, flags: 0x0},
- 793: {region: 0x164, script: 0x52, flags: 0x0},
- 794: {region: 0x164, script: 0x52, flags: 0x0},
- 795: {region: 0x98, script: 0x20, flags: 0x0},
- 796: {region: 0x51, script: 0x52, flags: 0x0},
- 798: {region: 0x164, script: 0x52, flags: 0x0},
- 799: {region: 0x134, script: 0x52, flags: 0x0},
- 800: {region: 0x164, script: 0x52, flags: 0x0},
- 801: {region: 0x164, script: 0x52, flags: 0x0},
- 802: {region: 0xe7, script: 0x5, flags: 0x0},
- 803: {region: 0xc2, script: 0x52, flags: 0x0},
- 804: {region: 0x98, script: 0x20, flags: 0x0},
- 805: {region: 0x94, script: 0x52, flags: 0x0},
- 806: {region: 0x163, script: 0x52, flags: 0x0},
- 807: {region: 0x164, script: 0x52, flags: 0x0},
- 808: {region: 0xc3, script: 0x6b, flags: 0x0},
- 809: {region: 0x164, script: 0x52, flags: 0x0},
- 810: {region: 0x164, script: 0x27, flags: 0x0},
- 811: {region: 0x105, script: 0x1e, flags: 0x0},
- 812: {region: 0x164, script: 0x52, flags: 0x0},
- 813: {region: 0x130, script: 0x52, flags: 0x0},
- 814: {region: 0x9b, script: 0x5d, flags: 0x0},
- 815: {region: 0x164, script: 0x52, flags: 0x0},
- 816: {region: 0x164, script: 0x52, flags: 0x0},
- 817: {region: 0x9b, script: 0x5, flags: 0x0},
- 818: {region: 0x164, script: 0x52, flags: 0x0},
- 819: {region: 0x164, script: 0x52, flags: 0x0},
- 820: {region: 0x164, script: 0x52, flags: 0x0},
- 821: {region: 0xdc, script: 0x52, flags: 0x0},
- 822: {region: 0x164, script: 0x52, flags: 0x0},
- 823: {region: 0x164, script: 0x52, flags: 0x0},
- 825: {region: 0x164, script: 0x52, flags: 0x0},
- 826: {region: 0x52, script: 0x34, flags: 0x0},
- 827: {region: 0x9d, script: 0x52, flags: 0x0},
- 828: {region: 0xd1, script: 0x52, flags: 0x0},
- 829: {region: 0x164, script: 0x52, flags: 0x0},
- 830: {region: 0xd9, script: 0x52, flags: 0x0},
- 831: {region: 0x164, script: 0x52, flags: 0x0},
- 832: {region: 0x164, script: 0x52, flags: 0x0},
- 833: {region: 0x164, script: 0x52, flags: 0x0},
- 834: {region: 0xce, script: 0x52, flags: 0x0},
- 835: {region: 0x164, script: 0x52, flags: 0x0},
- 836: {region: 0x164, script: 0x52, flags: 0x0},
- 837: {region: 0x163, script: 0x52, flags: 0x0},
- 838: {region: 0xd0, script: 0x52, flags: 0x0},
- 839: {region: 0x5f, script: 0x52, flags: 0x0},
- 840: {region: 0xda, script: 0x20, flags: 0x0},
- 841: {region: 0x164, script: 0x52, flags: 0x0},
- 842: {region: 0xda, script: 0x20, flags: 0x0},
- 843: {region: 0x164, script: 0x52, flags: 0x0},
- 844: {region: 0x164, script: 0x52, flags: 0x0},
- 845: {region: 0xd1, script: 0x52, flags: 0x0},
- 846: {region: 0x164, script: 0x52, flags: 0x0},
- 847: {region: 0x164, script: 0x52, flags: 0x0},
- 848: {region: 0xd0, script: 0x52, flags: 0x0},
- 849: {region: 0x164, script: 0x52, flags: 0x0},
- 850: {region: 0xce, script: 0x52, flags: 0x0},
- 851: {region: 0xce, script: 0x52, flags: 0x0},
- 852: {region: 0x164, script: 0x52, flags: 0x0},
- 853: {region: 0x164, script: 0x52, flags: 0x0},
- 854: {region: 0x94, script: 0x52, flags: 0x0},
- 855: {region: 0x164, script: 0x52, flags: 0x0},
- 856: {region: 0xde, script: 0x52, flags: 0x0},
- 857: {region: 0x164, script: 0x52, flags: 0x0},
- 858: {region: 0x164, script: 0x52, flags: 0x0},
- 859: {region: 0x98, script: 0x52, flags: 0x0},
- 860: {region: 0x164, script: 0x52, flags: 0x0},
- 861: {region: 0x164, script: 0x52, flags: 0x0},
- 862: {region: 0xd8, script: 0x52, flags: 0x0},
- 863: {region: 0x51, script: 0x52, flags: 0x0},
- 864: {region: 0x164, script: 0x52, flags: 0x0},
- 865: {region: 0xd9, script: 0x52, flags: 0x0},
- 866: {region: 0x164, script: 0x52, flags: 0x0},
- 867: {region: 0x51, script: 0x52, flags: 0x0},
- 868: {region: 0x164, script: 0x52, flags: 0x0},
- 869: {region: 0x164, script: 0x52, flags: 0x0},
- 870: {region: 0xd9, script: 0x52, flags: 0x0},
- 871: {region: 0x122, script: 0x4e, flags: 0x0},
- 872: {region: 0x98, script: 0x20, flags: 0x0},
- 873: {region: 0x10b, script: 0xb7, flags: 0x0},
- 874: {region: 0x164, script: 0x52, flags: 0x0},
- 875: {region: 0x164, script: 0x52, flags: 0x0},
- 876: {region: 0x83, script: 0x70, flags: 0x0},
- 877: {region: 0x160, script: 0x52, flags: 0x0},
- 878: {region: 0x164, script: 0x52, flags: 0x0},
- 879: {region: 0x48, script: 0x17, flags: 0x0},
- 880: {region: 0x164, script: 0x52, flags: 0x0},
- 881: {region: 0x160, script: 0x52, flags: 0x0},
- 882: {region: 0x164, script: 0x52, flags: 0x0},
- 883: {region: 0x164, script: 0x52, flags: 0x0},
- 884: {region: 0x164, script: 0x52, flags: 0x0},
- 885: {region: 0x164, script: 0x52, flags: 0x0},
- 886: {region: 0x164, script: 0x52, flags: 0x0},
- 887: {region: 0x116, script: 0x52, flags: 0x0},
- 888: {region: 0x164, script: 0x52, flags: 0x0},
- 889: {region: 0x164, script: 0x52, flags: 0x0},
- 890: {region: 0x134, script: 0x52, flags: 0x0},
- 891: {region: 0x164, script: 0x52, flags: 0x0},
- 892: {region: 0x52, script: 0x52, flags: 0x0},
- 893: {region: 0x164, script: 0x52, flags: 0x0},
- 894: {region: 0xcd, script: 0x52, flags: 0x0},
- 895: {region: 0x12e, script: 0x52, flags: 0x0},
- 896: {region: 0x130, script: 0x52, flags: 0x0},
- 897: {region: 0x7f, script: 0x52, flags: 0x0},
- 898: {region: 0x77, script: 0x52, flags: 0x0},
- 899: {region: 0x164, script: 0x52, flags: 0x0},
- 901: {region: 0x164, script: 0x52, flags: 0x0},
- 902: {region: 0x164, script: 0x52, flags: 0x0},
- 903: {region: 0x6e, script: 0x52, flags: 0x0},
- 904: {region: 0x164, script: 0x52, flags: 0x0},
- 905: {region: 0x164, script: 0x52, flags: 0x0},
- 906: {region: 0x164, script: 0x52, flags: 0x0},
- 907: {region: 0x164, script: 0x52, flags: 0x0},
- 908: {region: 0x98, script: 0x75, flags: 0x0},
- 909: {region: 0x164, script: 0x52, flags: 0x0},
- 910: {region: 0x164, script: 0x5, flags: 0x0},
- 911: {region: 0x7c, script: 0x1e, flags: 0x0},
- 912: {region: 0x134, script: 0x76, flags: 0x0},
- 913: {region: 0x164, script: 0x5, flags: 0x0},
- 914: {region: 0xc4, script: 0x74, flags: 0x0},
- 915: {region: 0x164, script: 0x52, flags: 0x0},
- 916: {region: 0x2e, script: 0x3, flags: 0x1},
- 917: {region: 0xe6, script: 0x52, flags: 0x0},
- 918: {region: 0x31, script: 0x2, flags: 0x1},
- 919: {region: 0xe6, script: 0x52, flags: 0x0},
- 920: {region: 0x2f, script: 0x52, flags: 0x0},
- 921: {region: 0xef, script: 0x52, flags: 0x0},
- 922: {region: 0x164, script: 0x52, flags: 0x0},
- 923: {region: 0x77, script: 0x52, flags: 0x0},
- 924: {region: 0xd5, script: 0x52, flags: 0x0},
- 925: {region: 0x134, script: 0x52, flags: 0x0},
- 926: {region: 0x48, script: 0x52, flags: 0x0},
- 927: {region: 0x164, script: 0x52, flags: 0x0},
- 928: {region: 0x9b, script: 0xdd, flags: 0x0},
- 929: {region: 0x164, script: 0x52, flags: 0x0},
- 930: {region: 0x5f, script: 0x52, flags: 0x0},
- 931: {region: 0x164, script: 0x5, flags: 0x0},
- 932: {region: 0xaf, script: 0x7f, flags: 0x0},
- 934: {region: 0x164, script: 0x52, flags: 0x0},
- 935: {region: 0x164, script: 0x52, flags: 0x0},
- 936: {region: 0x98, script: 0x12, flags: 0x0},
- 937: {region: 0xa3, script: 0x52, flags: 0x0},
- 938: {region: 0xe8, script: 0x52, flags: 0x0},
- 939: {region: 0x164, script: 0x52, flags: 0x0},
- 940: {region: 0x9d, script: 0x52, flags: 0x0},
- 941: {region: 0x164, script: 0x52, flags: 0x0},
- 942: {region: 0x164, script: 0x52, flags: 0x0},
- 943: {region: 0x86, script: 0x2d, flags: 0x0},
- 944: {region: 0x74, script: 0x52, flags: 0x0},
- 945: {region: 0x164, script: 0x52, flags: 0x0},
- 946: {region: 0xe7, script: 0x45, flags: 0x0},
- 947: {region: 0x9b, script: 0x5, flags: 0x0},
- 948: {region: 0x1, script: 0x52, flags: 0x0},
- 949: {region: 0x23, script: 0x5, flags: 0x0},
- 950: {region: 0x164, script: 0x52, flags: 0x0},
- 951: {region: 0x40, script: 0x52, flags: 0x0},
- 952: {region: 0x164, script: 0x52, flags: 0x0},
- 953: {region: 0x79, script: 0x52, flags: 0x0},
- 954: {region: 0x164, script: 0x52, flags: 0x0},
- 955: {region: 0xe3, script: 0x52, flags: 0x0},
- 956: {region: 0x88, script: 0x52, flags: 0x0},
- 957: {region: 0x68, script: 0x52, flags: 0x0},
- 958: {region: 0x164, script: 0x52, flags: 0x0},
- 959: {region: 0x98, script: 0x20, flags: 0x0},
- 960: {region: 0x164, script: 0x52, flags: 0x0},
- 961: {region: 0x101, script: 0x52, flags: 0x0},
- 962: {region: 0x94, script: 0x52, flags: 0x0},
- 963: {region: 0x164, script: 0x52, flags: 0x0},
- 964: {region: 0x164, script: 0x52, flags: 0x0},
- 965: {region: 0x9d, script: 0x52, flags: 0x0},
- 966: {region: 0x164, script: 0x5, flags: 0x0},
- 967: {region: 0x98, script: 0x52, flags: 0x0},
- 968: {region: 0x33, script: 0x2, flags: 0x1},
- 969: {region: 0xda, script: 0x20, flags: 0x0},
- 970: {region: 0x34, script: 0xe, flags: 0x0},
- 971: {region: 0x4d, script: 0x52, flags: 0x0},
- 972: {region: 0x71, script: 0x52, flags: 0x0},
- 973: {region: 0x4d, script: 0x52, flags: 0x0},
- 974: {region: 0x9b, script: 0x5, flags: 0x0},
- 975: {region: 0x10b, script: 0x52, flags: 0x0},
- 976: {region: 0x39, script: 0x52, flags: 0x0},
- 977: {region: 0x164, script: 0x52, flags: 0x0},
- 978: {region: 0xd0, script: 0x52, flags: 0x0},
- 979: {region: 0x103, script: 0x52, flags: 0x0},
- 980: {region: 0x94, script: 0x52, flags: 0x0},
- 981: {region: 0x12e, script: 0x52, flags: 0x0},
- 982: {region: 0x164, script: 0x52, flags: 0x0},
- 983: {region: 0x164, script: 0x52, flags: 0x0},
- 984: {region: 0x72, script: 0x52, flags: 0x0},
- 985: {region: 0x105, script: 0x1e, flags: 0x0},
- 986: {region: 0x12f, script: 0x1e, flags: 0x0},
- 987: {region: 0x108, script: 0x52, flags: 0x0},
- 988: {region: 0x106, script: 0x52, flags: 0x0},
- 989: {region: 0x12e, script: 0x52, flags: 0x0},
- 990: {region: 0x164, script: 0x52, flags: 0x0},
- 991: {region: 0xa1, script: 0x44, flags: 0x0},
- 992: {region: 0x98, script: 0x20, flags: 0x0},
- 993: {region: 0x7f, script: 0x52, flags: 0x0},
- 994: {region: 0x105, script: 0x1e, flags: 0x0},
- 995: {region: 0xa3, script: 0x52, flags: 0x0},
- 996: {region: 0x94, script: 0x52, flags: 0x0},
- 997: {region: 0x98, script: 0x52, flags: 0x0},
- 998: {region: 0x98, script: 0xbb, flags: 0x0},
- 999: {region: 0x164, script: 0x52, flags: 0x0},
- 1000: {region: 0x164, script: 0x52, flags: 0x0},
- 1001: {region: 0x12e, script: 0x52, flags: 0x0},
- 1002: {region: 0x9d, script: 0x52, flags: 0x0},
- 1003: {region: 0x98, script: 0x20, flags: 0x0},
- 1004: {region: 0x164, script: 0x5, flags: 0x0},
- 1005: {region: 0x9d, script: 0x52, flags: 0x0},
- 1006: {region: 0x7a, script: 0x52, flags: 0x0},
- 1007: {region: 0x48, script: 0x52, flags: 0x0},
- 1008: {region: 0x35, script: 0x4, flags: 0x1},
- 1009: {region: 0x9d, script: 0x52, flags: 0x0},
- 1010: {region: 0x9b, script: 0x5, flags: 0x0},
- 1011: {region: 0xd9, script: 0x52, flags: 0x0},
- 1012: {region: 0x4e, script: 0x52, flags: 0x0},
- 1013: {region: 0xd0, script: 0x52, flags: 0x0},
- 1014: {region: 0xce, script: 0x52, flags: 0x0},
- 1015: {region: 0xc2, script: 0x52, flags: 0x0},
- 1016: {region: 0x4b, script: 0x52, flags: 0x0},
- 1017: {region: 0x95, script: 0x72, flags: 0x0},
- 1018: {region: 0xb5, script: 0x52, flags: 0x0},
- 1019: {region: 0x164, script: 0x27, flags: 0x0},
- 1020: {region: 0x164, script: 0x52, flags: 0x0},
- 1022: {region: 0xb9, script: 0xd2, flags: 0x0},
- 1023: {region: 0x164, script: 0x52, flags: 0x0},
- 1024: {region: 0xc3, script: 0x6b, flags: 0x0},
- 1025: {region: 0x164, script: 0x5, flags: 0x0},
- 1026: {region: 0xb2, script: 0xc1, flags: 0x0},
- 1027: {region: 0x6e, script: 0x52, flags: 0x0},
- 1028: {region: 0x164, script: 0x52, flags: 0x0},
- 1029: {region: 0x164, script: 0x52, flags: 0x0},
- 1030: {region: 0x164, script: 0x52, flags: 0x0},
- 1031: {region: 0x164, script: 0x52, flags: 0x0},
- 1032: {region: 0x110, script: 0x52, flags: 0x0},
- 1033: {region: 0x164, script: 0x52, flags: 0x0},
- 1034: {region: 0xe7, script: 0x5, flags: 0x0},
- 1035: {region: 0x164, script: 0x52, flags: 0x0},
- 1036: {region: 0x10e, script: 0x52, flags: 0x0},
- 1037: {region: 0x164, script: 0x52, flags: 0x0},
- 1038: {region: 0xe8, script: 0x52, flags: 0x0},
- 1039: {region: 0x164, script: 0x52, flags: 0x0},
- 1040: {region: 0x94, script: 0x52, flags: 0x0},
- 1041: {region: 0x141, script: 0x52, flags: 0x0},
- 1042: {region: 0x10b, script: 0x52, flags: 0x0},
- 1044: {region: 0x10b, script: 0x52, flags: 0x0},
- 1045: {region: 0x71, script: 0x52, flags: 0x0},
- 1046: {region: 0x96, script: 0xb8, flags: 0x0},
- 1047: {region: 0x164, script: 0x52, flags: 0x0},
- 1048: {region: 0x71, script: 0x52, flags: 0x0},
- 1049: {region: 0x163, script: 0x52, flags: 0x0},
- 1050: {region: 0x164, script: 0x52, flags: 0x0},
- 1051: {region: 0xc2, script: 0x52, flags: 0x0},
- 1052: {region: 0x164, script: 0x52, flags: 0x0},
- 1053: {region: 0x164, script: 0x52, flags: 0x0},
- 1054: {region: 0x164, script: 0x52, flags: 0x0},
- 1055: {region: 0x114, script: 0x52, flags: 0x0},
- 1056: {region: 0x164, script: 0x52, flags: 0x0},
- 1057: {region: 0x164, script: 0x52, flags: 0x0},
- 1058: {region: 0x122, script: 0xd5, flags: 0x0},
- 1059: {region: 0x164, script: 0x52, flags: 0x0},
- 1060: {region: 0x164, script: 0x52, flags: 0x0},
- 1061: {region: 0x164, script: 0x52, flags: 0x0},
- 1062: {region: 0x164, script: 0x52, flags: 0x0},
- 1063: {region: 0x26, script: 0x52, flags: 0x0},
- 1064: {region: 0x39, script: 0x5, flags: 0x1},
- 1065: {region: 0x98, script: 0xc2, flags: 0x0},
- 1066: {region: 0x115, script: 0x52, flags: 0x0},
- 1067: {region: 0x113, script: 0x52, flags: 0x0},
- 1068: {region: 0x98, script: 0x20, flags: 0x0},
- 1069: {region: 0x160, script: 0x52, flags: 0x0},
- 1070: {region: 0x164, script: 0x52, flags: 0x0},
- 1071: {region: 0x164, script: 0x52, flags: 0x0},
- 1072: {region: 0x6c, script: 0x52, flags: 0x0},
- 1073: {region: 0x160, script: 0x52, flags: 0x0},
- 1074: {region: 0x164, script: 0x52, flags: 0x0},
- 1075: {region: 0x5f, script: 0x52, flags: 0x0},
- 1076: {region: 0x94, script: 0x52, flags: 0x0},
- 1077: {region: 0x164, script: 0x52, flags: 0x0},
- 1078: {region: 0x164, script: 0x52, flags: 0x0},
- 1079: {region: 0x12e, script: 0x52, flags: 0x0},
- 1080: {region: 0x164, script: 0x52, flags: 0x0},
- 1081: {region: 0x83, script: 0x52, flags: 0x0},
- 1082: {region: 0x10b, script: 0x52, flags: 0x0},
- 1083: {region: 0x12e, script: 0x52, flags: 0x0},
- 1084: {region: 0x15e, script: 0x5, flags: 0x0},
- 1085: {region: 0x4a, script: 0x52, flags: 0x0},
- 1086: {region: 0x5f, script: 0x52, flags: 0x0},
- 1087: {region: 0x164, script: 0x52, flags: 0x0},
- 1088: {region: 0x98, script: 0x20, flags: 0x0},
- 1089: {region: 0x94, script: 0x52, flags: 0x0},
- 1090: {region: 0x164, script: 0x52, flags: 0x0},
- 1091: {region: 0x34, script: 0xe, flags: 0x0},
- 1092: {region: 0x9a, script: 0xc5, flags: 0x0},
- 1093: {region: 0xe8, script: 0x52, flags: 0x0},
- 1094: {region: 0x98, script: 0xcd, flags: 0x0},
- 1095: {region: 0xda, script: 0x20, flags: 0x0},
- 1096: {region: 0x164, script: 0x52, flags: 0x0},
- 1097: {region: 0x164, script: 0x52, flags: 0x0},
- 1098: {region: 0x164, script: 0x52, flags: 0x0},
- 1099: {region: 0x164, script: 0x52, flags: 0x0},
- 1100: {region: 0x164, script: 0x52, flags: 0x0},
- 1101: {region: 0x164, script: 0x52, flags: 0x0},
- 1102: {region: 0x164, script: 0x52, flags: 0x0},
- 1103: {region: 0x164, script: 0x52, flags: 0x0},
- 1104: {region: 0xe6, script: 0x52, flags: 0x0},
- 1105: {region: 0x164, script: 0x52, flags: 0x0},
- 1106: {region: 0x164, script: 0x52, flags: 0x0},
- 1107: {region: 0x98, script: 0x4a, flags: 0x0},
- 1108: {region: 0x52, script: 0xcb, flags: 0x0},
- 1109: {region: 0xda, script: 0x20, flags: 0x0},
- 1110: {region: 0xda, script: 0x20, flags: 0x0},
- 1111: {region: 0x98, script: 0xd0, flags: 0x0},
- 1112: {region: 0x164, script: 0x52, flags: 0x0},
- 1113: {region: 0x111, script: 0x52, flags: 0x0},
- 1114: {region: 0x130, script: 0x52, flags: 0x0},
- 1115: {region: 0x125, script: 0x52, flags: 0x0},
- 1116: {region: 0x164, script: 0x52, flags: 0x0},
- 1117: {region: 0x3e, script: 0x3, flags: 0x1},
- 1118: {region: 0x164, script: 0x52, flags: 0x0},
- 1119: {region: 0x164, script: 0x52, flags: 0x0},
- 1120: {region: 0x164, script: 0x52, flags: 0x0},
- 1121: {region: 0x122, script: 0xd5, flags: 0x0},
- 1122: {region: 0xda, script: 0x20, flags: 0x0},
- 1123: {region: 0xda, script: 0x20, flags: 0x0},
- 1124: {region: 0xda, script: 0x20, flags: 0x0},
- 1125: {region: 0x6e, script: 0x27, flags: 0x0},
- 1126: {region: 0x164, script: 0x52, flags: 0x0},
- 1127: {region: 0x6c, script: 0x27, flags: 0x0},
- 1128: {region: 0x164, script: 0x52, flags: 0x0},
- 1129: {region: 0x164, script: 0x52, flags: 0x0},
- 1130: {region: 0x164, script: 0x52, flags: 0x0},
- 1131: {region: 0xd5, script: 0x52, flags: 0x0},
- 1132: {region: 0x126, script: 0x52, flags: 0x0},
- 1133: {region: 0x124, script: 0x52, flags: 0x0},
- 1134: {region: 0x31, script: 0x52, flags: 0x0},
- 1135: {region: 0xda, script: 0x20, flags: 0x0},
- 1136: {region: 0xe6, script: 0x52, flags: 0x0},
- 1137: {region: 0x164, script: 0x52, flags: 0x0},
- 1138: {region: 0x164, script: 0x52, flags: 0x0},
- 1139: {region: 0x31, script: 0x52, flags: 0x0},
- 1140: {region: 0xd3, script: 0x52, flags: 0x0},
- 1141: {region: 0x164, script: 0x52, flags: 0x0},
- 1142: {region: 0x160, script: 0x52, flags: 0x0},
- 1143: {region: 0x164, script: 0x52, flags: 0x0},
- 1144: {region: 0x128, script: 0x52, flags: 0x0},
- 1145: {region: 0x164, script: 0x52, flags: 0x0},
- 1146: {region: 0xcd, script: 0x52, flags: 0x0},
- 1147: {region: 0x164, script: 0x52, flags: 0x0},
- 1148: {region: 0xe5, script: 0x52, flags: 0x0},
- 1149: {region: 0x164, script: 0x52, flags: 0x0},
- 1150: {region: 0x164, script: 0x52, flags: 0x0},
- 1151: {region: 0x164, script: 0x52, flags: 0x0},
- 1152: {region: 0x12a, script: 0x52, flags: 0x0},
- 1153: {region: 0x12a, script: 0x52, flags: 0x0},
- 1154: {region: 0x12d, script: 0x52, flags: 0x0},
- 1155: {region: 0x164, script: 0x5, flags: 0x0},
- 1156: {region: 0x160, script: 0x52, flags: 0x0},
- 1157: {region: 0x86, script: 0x2d, flags: 0x0},
- 1158: {region: 0xda, script: 0x20, flags: 0x0},
- 1159: {region: 0xe6, script: 0x52, flags: 0x0},
- 1160: {region: 0x42, script: 0xd6, flags: 0x0},
- 1161: {region: 0x164, script: 0x52, flags: 0x0},
- 1162: {region: 0x105, script: 0x1e, flags: 0x0},
- 1163: {region: 0x164, script: 0x52, flags: 0x0},
- 1164: {region: 0x164, script: 0x52, flags: 0x0},
- 1165: {region: 0x130, script: 0x52, flags: 0x0},
- 1166: {region: 0x164, script: 0x52, flags: 0x0},
- 1167: {region: 0x122, script: 0xd5, flags: 0x0},
- 1168: {region: 0x31, script: 0x52, flags: 0x0},
- 1169: {region: 0x164, script: 0x52, flags: 0x0},
- 1170: {region: 0x164, script: 0x52, flags: 0x0},
- 1171: {region: 0xcd, script: 0x52, flags: 0x0},
- 1172: {region: 0x164, script: 0x52, flags: 0x0},
- 1173: {region: 0x164, script: 0x52, flags: 0x0},
- 1174: {region: 0x12c, script: 0x52, flags: 0x0},
- 1175: {region: 0x164, script: 0x52, flags: 0x0},
- 1177: {region: 0x164, script: 0x52, flags: 0x0},
- 1178: {region: 0xd3, script: 0x52, flags: 0x0},
- 1179: {region: 0x52, script: 0xce, flags: 0x0},
- 1180: {region: 0xe4, script: 0x52, flags: 0x0},
- 1181: {region: 0x164, script: 0x52, flags: 0x0},
- 1182: {region: 0x105, script: 0x1e, flags: 0x0},
- 1183: {region: 0xb9, script: 0x52, flags: 0x0},
- 1184: {region: 0x164, script: 0x52, flags: 0x0},
- 1185: {region: 0x105, script: 0x1e, flags: 0x0},
- 1186: {region: 0x41, script: 0x4, flags: 0x1},
- 1187: {region: 0x11b, script: 0xd8, flags: 0x0},
- 1188: {region: 0x12f, script: 0x1e, flags: 0x0},
- 1189: {region: 0x74, script: 0x52, flags: 0x0},
- 1190: {region: 0x29, script: 0x52, flags: 0x0},
- 1192: {region: 0x45, script: 0x3, flags: 0x1},
- 1193: {region: 0x98, script: 0xe, flags: 0x0},
- 1194: {region: 0xe7, script: 0x5, flags: 0x0},
- 1195: {region: 0x164, script: 0x52, flags: 0x0},
- 1196: {region: 0x164, script: 0x52, flags: 0x0},
- 1197: {region: 0x164, script: 0x52, flags: 0x0},
- 1198: {region: 0x164, script: 0x52, flags: 0x0},
- 1199: {region: 0x164, script: 0x52, flags: 0x0},
- 1200: {region: 0x164, script: 0x52, flags: 0x0},
- 1201: {region: 0x164, script: 0x52, flags: 0x0},
- 1202: {region: 0x48, script: 0x4, flags: 0x1},
- 1203: {region: 0x164, script: 0x52, flags: 0x0},
- 1204: {region: 0xb3, script: 0xd9, flags: 0x0},
- 1205: {region: 0x164, script: 0x52, flags: 0x0},
- 1206: {region: 0x160, script: 0x52, flags: 0x0},
- 1207: {region: 0x9d, script: 0x52, flags: 0x0},
- 1208: {region: 0x105, script: 0x52, flags: 0x0},
- 1209: {region: 0x13d, script: 0x52, flags: 0x0},
- 1210: {region: 0x11a, script: 0x52, flags: 0x0},
- 1211: {region: 0x164, script: 0x52, flags: 0x0},
- 1212: {region: 0x35, script: 0x52, flags: 0x0},
- 1213: {region: 0x5f, script: 0x52, flags: 0x0},
- 1214: {region: 0xd0, script: 0x52, flags: 0x0},
- 1215: {region: 0x1, script: 0x52, flags: 0x0},
- 1216: {region: 0x105, script: 0x52, flags: 0x0},
- 1217: {region: 0x69, script: 0x52, flags: 0x0},
- 1218: {region: 0x12e, script: 0x52, flags: 0x0},
- 1219: {region: 0x164, script: 0x52, flags: 0x0},
- 1220: {region: 0x35, script: 0x52, flags: 0x0},
- 1221: {region: 0x4d, script: 0x52, flags: 0x0},
- 1222: {region: 0x164, script: 0x52, flags: 0x0},
- 1223: {region: 0x6e, script: 0x27, flags: 0x0},
- 1224: {region: 0x164, script: 0x52, flags: 0x0},
- 1225: {region: 0xe6, script: 0x52, flags: 0x0},
- 1226: {region: 0x2e, script: 0x52, flags: 0x0},
- 1227: {region: 0x98, script: 0xd0, flags: 0x0},
- 1228: {region: 0x98, script: 0x20, flags: 0x0},
- 1229: {region: 0x164, script: 0x52, flags: 0x0},
- 1230: {region: 0x164, script: 0x52, flags: 0x0},
- 1231: {region: 0x164, script: 0x52, flags: 0x0},
- 1232: {region: 0x164, script: 0x52, flags: 0x0},
- 1233: {region: 0x164, script: 0x52, flags: 0x0},
- 1234: {region: 0x164, script: 0x52, flags: 0x0},
- 1235: {region: 0x164, script: 0x52, flags: 0x0},
- 1236: {region: 0x164, script: 0x52, flags: 0x0},
- 1237: {region: 0x164, script: 0x52, flags: 0x0},
- 1238: {region: 0x13f, script: 0x52, flags: 0x0},
- 1239: {region: 0x164, script: 0x52, flags: 0x0},
- 1240: {region: 0x164, script: 0x52, flags: 0x0},
- 1241: {region: 0xa7, script: 0x5, flags: 0x0},
- 1242: {region: 0x164, script: 0x52, flags: 0x0},
- 1243: {region: 0x113, script: 0x52, flags: 0x0},
- 1244: {region: 0x164, script: 0x52, flags: 0x0},
- 1245: {region: 0x164, script: 0x52, flags: 0x0},
- 1246: {region: 0x164, script: 0x52, flags: 0x0},
- 1247: {region: 0x164, script: 0x52, flags: 0x0},
- 1248: {region: 0x98, script: 0x20, flags: 0x0},
- 1249: {region: 0x52, script: 0x34, flags: 0x0},
- 1250: {region: 0x164, script: 0x52, flags: 0x0},
- 1251: {region: 0x164, script: 0x52, flags: 0x0},
- 1252: {region: 0x40, script: 0x52, flags: 0x0},
- 1253: {region: 0x164, script: 0x52, flags: 0x0},
- 1254: {region: 0x12a, script: 0x18, flags: 0x0},
- 1255: {region: 0x164, script: 0x52, flags: 0x0},
- 1256: {region: 0x160, script: 0x52, flags: 0x0},
- 1257: {region: 0x164, script: 0x52, flags: 0x0},
- 1258: {region: 0x12a, script: 0x5a, flags: 0x0},
- 1259: {region: 0x12a, script: 0x5b, flags: 0x0},
- 1260: {region: 0x7c, script: 0x29, flags: 0x0},
- 1261: {region: 0x52, script: 0x5e, flags: 0x0},
- 1262: {region: 0x10a, script: 0x62, flags: 0x0},
- 1263: {region: 0x107, script: 0x6c, flags: 0x0},
- 1264: {region: 0x98, script: 0x20, flags: 0x0},
- 1265: {region: 0x130, script: 0x52, flags: 0x0},
- 1266: {region: 0x164, script: 0x52, flags: 0x0},
- 1267: {region: 0x9b, script: 0x82, flags: 0x0},
- 1268: {region: 0x164, script: 0x52, flags: 0x0},
- 1269: {region: 0x15d, script: 0xba, flags: 0x0},
- 1270: {region: 0x164, script: 0x52, flags: 0x0},
- 1271: {region: 0x164, script: 0x52, flags: 0x0},
- 1272: {region: 0xda, script: 0x20, flags: 0x0},
- 1273: {region: 0x164, script: 0x52, flags: 0x0},
- 1274: {region: 0x164, script: 0x52, flags: 0x0},
- 1275: {region: 0xd0, script: 0x52, flags: 0x0},
- 1276: {region: 0x74, script: 0x52, flags: 0x0},
- 1277: {region: 0x164, script: 0x52, flags: 0x0},
- 1278: {region: 0x164, script: 0x52, flags: 0x0},
- 1279: {region: 0x51, script: 0x52, flags: 0x0},
- 1280: {region: 0x164, script: 0x52, flags: 0x0},
- 1281: {region: 0x164, script: 0x52, flags: 0x0},
- 1282: {region: 0x164, script: 0x52, flags: 0x0},
- 1283: {region: 0x51, script: 0x52, flags: 0x0},
- 1284: {region: 0x164, script: 0x52, flags: 0x0},
- 1285: {region: 0x164, script: 0x52, flags: 0x0},
- 1286: {region: 0x164, script: 0x52, flags: 0x0},
- 1287: {region: 0x164, script: 0x52, flags: 0x0},
- 1288: {region: 0x1, script: 0x37, flags: 0x0},
- 1289: {region: 0x164, script: 0x52, flags: 0x0},
- 1290: {region: 0x164, script: 0x52, flags: 0x0},
- 1291: {region: 0x164, script: 0x52, flags: 0x0},
- 1292: {region: 0x164, script: 0x52, flags: 0x0},
- 1293: {region: 0x164, script: 0x52, flags: 0x0},
- 1294: {region: 0xd5, script: 0x52, flags: 0x0},
- 1295: {region: 0x164, script: 0x52, flags: 0x0},
- 1296: {region: 0x164, script: 0x52, flags: 0x0},
- 1297: {region: 0x164, script: 0x52, flags: 0x0},
- 1298: {region: 0x40, script: 0x52, flags: 0x0},
- 1299: {region: 0x164, script: 0x52, flags: 0x0},
- 1300: {region: 0xce, script: 0x52, flags: 0x0},
- 1301: {region: 0x4c, script: 0x3, flags: 0x1},
- 1302: {region: 0x164, script: 0x52, flags: 0x0},
- 1303: {region: 0x164, script: 0x52, flags: 0x0},
- 1304: {region: 0x164, script: 0x52, flags: 0x0},
- 1305: {region: 0x52, script: 0x52, flags: 0x0},
- 1306: {region: 0x10a, script: 0x52, flags: 0x0},
- 1308: {region: 0xa7, script: 0x5, flags: 0x0},
- 1309: {region: 0xd8, script: 0x52, flags: 0x0},
- 1310: {region: 0xb9, script: 0xd2, flags: 0x0},
- 1311: {region: 0x4f, script: 0x14, flags: 0x1},
- 1312: {region: 0x164, script: 0x52, flags: 0x0},
- 1313: {region: 0x121, script: 0x52, flags: 0x0},
- 1314: {region: 0xcf, script: 0x52, flags: 0x0},
- 1315: {region: 0x164, script: 0x52, flags: 0x0},
- 1316: {region: 0x160, script: 0x52, flags: 0x0},
- 1318: {region: 0x12a, script: 0x52, flags: 0x0},
-}
-
-// likelyLangList holds lists info associated with likelyLang.
-// Size: 396 bytes, 99 elements
-var likelyLangList = [99]likelyScriptRegion{
- 0: {region: 0x9b, script: 0x7, flags: 0x0},
- 1: {region: 0xa0, script: 0x6d, flags: 0x2},
- 2: {region: 0x11b, script: 0x78, flags: 0x2},
- 3: {region: 0x31, script: 0x52, flags: 0x0},
- 4: {region: 0x9a, script: 0x5, flags: 0x4},
- 5: {region: 0x9b, script: 0x5, flags: 0x4},
- 6: {region: 0x105, script: 0x1e, flags: 0x4},
- 7: {region: 0x9b, script: 0x5, flags: 0x2},
- 8: {region: 0x98, script: 0xe, flags: 0x0},
- 9: {region: 0x34, script: 0x16, flags: 0x2},
- 10: {region: 0x105, script: 0x1e, flags: 0x0},
- 11: {region: 0x37, script: 0x2a, flags: 0x2},
- 12: {region: 0x134, script: 0x52, flags: 0x0},
- 13: {region: 0x7a, script: 0xbd, flags: 0x2},
- 14: {region: 0x113, script: 0x52, flags: 0x0},
- 15: {region: 0x83, script: 0x1, flags: 0x2},
- 16: {region: 0x5c, script: 0x1d, flags: 0x0},
- 17: {region: 0x86, script: 0x57, flags: 0x2},
- 18: {region: 0xd5, script: 0x52, flags: 0x0},
- 19: {region: 0x51, script: 0x5, flags: 0x4},
- 20: {region: 0x10a, script: 0x5, flags: 0x4},
- 21: {region: 0xad, script: 0x1e, flags: 0x0},
- 22: {region: 0x23, script: 0x5, flags: 0x4},
- 23: {region: 0x52, script: 0x5, flags: 0x4},
- 24: {region: 0x9b, script: 0x5, flags: 0x4},
- 25: {region: 0xc4, script: 0x5, flags: 0x4},
- 26: {region: 0x52, script: 0x5, flags: 0x2},
- 27: {region: 0x12a, script: 0x52, flags: 0x0},
- 28: {region: 0xaf, script: 0x5, flags: 0x4},
- 29: {region: 0x9a, script: 0x5, flags: 0x2},
- 30: {region: 0xa4, script: 0x1e, flags: 0x0},
- 31: {region: 0x52, script: 0x5, flags: 0x4},
- 32: {region: 0x12a, script: 0x52, flags: 0x4},
- 33: {region: 0x52, script: 0x5, flags: 0x2},
- 34: {region: 0x12a, script: 0x52, flags: 0x2},
- 35: {region: 0xda, script: 0x20, flags: 0x0},
- 36: {region: 0x98, script: 0x55, flags: 0x2},
- 37: {region: 0x82, script: 0x52, flags: 0x0},
- 38: {region: 0x83, script: 0x70, flags: 0x4},
- 39: {region: 0x83, script: 0x70, flags: 0x2},
- 40: {region: 0xc4, script: 0x1e, flags: 0x0},
- 41: {region: 0x52, script: 0x66, flags: 0x4},
- 42: {region: 0x52, script: 0x66, flags: 0x2},
- 43: {region: 0xcf, script: 0x52, flags: 0x0},
- 44: {region: 0x49, script: 0x5, flags: 0x4},
- 45: {region: 0x94, script: 0x5, flags: 0x4},
- 46: {region: 0x98, script: 0x2f, flags: 0x0},
- 47: {region: 0xe7, script: 0x5, flags: 0x4},
- 48: {region: 0xe7, script: 0x5, flags: 0x2},
- 49: {region: 0x9b, script: 0x7c, flags: 0x0},
- 50: {region: 0x52, script: 0x7d, flags: 0x2},
- 51: {region: 0xb9, script: 0xd2, flags: 0x0},
- 52: {region: 0xd8, script: 0x52, flags: 0x4},
- 53: {region: 0xe7, script: 0x5, flags: 0x0},
- 54: {region: 0x98, script: 0x20, flags: 0x2},
- 55: {region: 0x98, script: 0x47, flags: 0x2},
- 56: {region: 0x98, script: 0xc0, flags: 0x2},
- 57: {region: 0x104, script: 0x1e, flags: 0x0},
- 58: {region: 0xbc, script: 0x52, flags: 0x4},
- 59: {region: 0x103, script: 0x52, flags: 0x4},
- 60: {region: 0x105, script: 0x52, flags: 0x4},
- 61: {region: 0x12a, script: 0x52, flags: 0x4},
- 62: {region: 0x123, script: 0x1e, flags: 0x0},
- 63: {region: 0xe7, script: 0x5, flags: 0x4},
- 64: {region: 0xe7, script: 0x5, flags: 0x2},
- 65: {region: 0x52, script: 0x5, flags: 0x0},
- 66: {region: 0xad, script: 0x1e, flags: 0x4},
- 67: {region: 0xc4, script: 0x1e, flags: 0x4},
- 68: {region: 0xad, script: 0x1e, flags: 0x2},
- 69: {region: 0x98, script: 0xe, flags: 0x0},
- 70: {region: 0xda, script: 0x20, flags: 0x4},
- 71: {region: 0xda, script: 0x20, flags: 0x2},
- 72: {region: 0x136, script: 0x52, flags: 0x0},
- 73: {region: 0x23, script: 0x5, flags: 0x4},
- 74: {region: 0x52, script: 0x1e, flags: 0x4},
- 75: {region: 0x23, script: 0x5, flags: 0x2},
- 76: {region: 0x8c, script: 0x35, flags: 0x0},
- 77: {region: 0x52, script: 0x34, flags: 0x4},
- 78: {region: 0x52, script: 0x34, flags: 0x2},
- 79: {region: 0x52, script: 0x34, flags: 0x0},
- 80: {region: 0x2e, script: 0x35, flags: 0x4},
- 81: {region: 0x3d, script: 0x35, flags: 0x4},
- 82: {region: 0x7a, script: 0x35, flags: 0x4},
- 83: {region: 0x7d, script: 0x35, flags: 0x4},
- 84: {region: 0x8c, script: 0x35, flags: 0x4},
- 85: {region: 0x94, script: 0x35, flags: 0x4},
- 86: {region: 0xc5, script: 0x35, flags: 0x4},
- 87: {region: 0xcf, script: 0x35, flags: 0x4},
- 88: {region: 0xe1, script: 0x35, flags: 0x4},
- 89: {region: 0xe4, script: 0x35, flags: 0x4},
- 90: {region: 0xe6, script: 0x35, flags: 0x4},
- 91: {region: 0x115, script: 0x35, flags: 0x4},
- 92: {region: 0x122, script: 0x35, flags: 0x4},
- 93: {region: 0x12d, script: 0x35, flags: 0x4},
- 94: {region: 0x134, script: 0x35, flags: 0x4},
- 95: {region: 0x13d, script: 0x35, flags: 0x4},
- 96: {region: 0x12d, script: 0x11, flags: 0x2},
- 97: {region: 0x12d, script: 0x30, flags: 0x2},
- 98: {region: 0x12d, script: 0x35, flags: 0x2},
-}
-
-type likelyLangScript struct {
- lang uint16
- script uint8
- flags uint8
-}
-
-// likelyRegion is a lookup table, indexed by regionID, for the most likely
-// languages and scripts given incomplete information. If more entries exist
-// for a given regionID, lang and script are the index and size respectively
-// of the list in likelyRegionList.
-// TODO: exclude containers and user-definable regions from the list.
-// Size: 1428 bytes, 357 elements
-var likelyRegion = [357]likelyLangScript{
- 33: {lang: 0xd5, script: 0x52, flags: 0x0},
- 34: {lang: 0x39, script: 0x5, flags: 0x0},
- 35: {lang: 0x0, script: 0x2, flags: 0x1},
- 38: {lang: 0x2, script: 0x2, flags: 0x1},
- 39: {lang: 0x4, script: 0x2, flags: 0x1},
- 41: {lang: 0x3b7, script: 0x52, flags: 0x0},
- 42: {lang: 0x0, script: 0x52, flags: 0x0},
- 43: {lang: 0x139, script: 0x52, flags: 0x0},
- 44: {lang: 0x411, script: 0x52, flags: 0x0},
- 45: {lang: 0x109, script: 0x52, flags: 0x0},
- 47: {lang: 0x35e, script: 0x52, flags: 0x0},
- 48: {lang: 0x43a, script: 0x52, flags: 0x0},
- 49: {lang: 0x57, script: 0x52, flags: 0x0},
- 50: {lang: 0x6, script: 0x2, flags: 0x1},
- 52: {lang: 0xa3, script: 0xe, flags: 0x0},
- 53: {lang: 0x35e, script: 0x52, flags: 0x0},
- 54: {lang: 0x159, script: 0x52, flags: 0x0},
- 55: {lang: 0x7d, script: 0x1e, flags: 0x0},
- 56: {lang: 0x39, script: 0x5, flags: 0x0},
- 57: {lang: 0x3d0, script: 0x52, flags: 0x0},
- 58: {lang: 0x159, script: 0x52, flags: 0x0},
- 59: {lang: 0x159, script: 0x52, flags: 0x0},
- 61: {lang: 0x316, script: 0x52, flags: 0x0},
- 62: {lang: 0x139, script: 0x52, flags: 0x0},
- 63: {lang: 0x398, script: 0x52, flags: 0x0},
- 64: {lang: 0x3b7, script: 0x52, flags: 0x0},
- 66: {lang: 0x8, script: 0x2, flags: 0x1},
- 68: {lang: 0x0, script: 0x52, flags: 0x0},
- 70: {lang: 0x70, script: 0x1e, flags: 0x0},
- 72: {lang: 0x508, script: 0x37, flags: 0x2},
- 73: {lang: 0x316, script: 0x5, flags: 0x2},
- 74: {lang: 0x43b, script: 0x52, flags: 0x0},
- 75: {lang: 0x159, script: 0x52, flags: 0x0},
- 76: {lang: 0x159, script: 0x52, flags: 0x0},
- 77: {lang: 0x109, script: 0x52, flags: 0x0},
- 78: {lang: 0x159, script: 0x52, flags: 0x0},
- 80: {lang: 0x139, script: 0x52, flags: 0x0},
- 81: {lang: 0x159, script: 0x52, flags: 0x0},
- 82: {lang: 0xa, script: 0x5, flags: 0x1},
- 83: {lang: 0x139, script: 0x52, flags: 0x0},
- 84: {lang: 0x0, script: 0x52, flags: 0x0},
- 85: {lang: 0x139, script: 0x52, flags: 0x0},
- 88: {lang: 0x139, script: 0x52, flags: 0x0},
- 89: {lang: 0x3b7, script: 0x52, flags: 0x0},
- 90: {lang: 0x398, script: 0x52, flags: 0x0},
- 92: {lang: 0xf, script: 0x2, flags: 0x1},
- 93: {lang: 0xf6, script: 0x52, flags: 0x0},
- 95: {lang: 0x109, script: 0x52, flags: 0x0},
- 97: {lang: 0x1, script: 0x52, flags: 0x0},
- 98: {lang: 0xfd, script: 0x52, flags: 0x0},
- 100: {lang: 0x139, script: 0x52, flags: 0x0},
- 102: {lang: 0x11, script: 0x2, flags: 0x1},
- 103: {lang: 0x139, script: 0x52, flags: 0x0},
- 104: {lang: 0x139, script: 0x52, flags: 0x0},
- 105: {lang: 0x13b, script: 0x52, flags: 0x0},
- 106: {lang: 0x39, script: 0x5, flags: 0x0},
- 107: {lang: 0x39, script: 0x5, flags: 0x0},
- 108: {lang: 0x465, script: 0x27, flags: 0x0},
- 109: {lang: 0x139, script: 0x52, flags: 0x0},
- 110: {lang: 0x13, script: 0x2, flags: 0x1},
- 112: {lang: 0x109, script: 0x52, flags: 0x0},
- 113: {lang: 0x14c, script: 0x52, flags: 0x0},
- 114: {lang: 0x1b9, script: 0x20, flags: 0x2},
- 117: {lang: 0x153, script: 0x52, flags: 0x0},
- 119: {lang: 0x159, script: 0x52, flags: 0x0},
- 121: {lang: 0x159, script: 0x52, flags: 0x0},
- 122: {lang: 0x15, script: 0x2, flags: 0x1},
- 124: {lang: 0x17, script: 0x3, flags: 0x1},
- 125: {lang: 0x159, script: 0x52, flags: 0x0},
- 127: {lang: 0x20, script: 0x52, flags: 0x0},
- 129: {lang: 0x23d, script: 0x52, flags: 0x0},
- 131: {lang: 0x159, script: 0x52, flags: 0x0},
- 132: {lang: 0x159, script: 0x52, flags: 0x0},
- 133: {lang: 0x139, script: 0x52, flags: 0x0},
- 134: {lang: 0x1a, script: 0x2, flags: 0x1},
- 135: {lang: 0x0, script: 0x52, flags: 0x0},
- 136: {lang: 0x139, script: 0x52, flags: 0x0},
- 138: {lang: 0x3b7, script: 0x52, flags: 0x0},
- 140: {lang: 0x51f, script: 0x35, flags: 0x0},
- 141: {lang: 0x0, script: 0x52, flags: 0x0},
- 142: {lang: 0x139, script: 0x52, flags: 0x0},
- 143: {lang: 0x1ca, script: 0x52, flags: 0x0},
- 144: {lang: 0x1cd, script: 0x52, flags: 0x0},
- 145: {lang: 0x1ce, script: 0x52, flags: 0x0},
- 147: {lang: 0x139, script: 0x52, flags: 0x0},
- 148: {lang: 0x1c, script: 0x2, flags: 0x1},
- 150: {lang: 0x1b5, script: 0x37, flags: 0x0},
- 152: {lang: 0x1e, script: 0x3, flags: 0x1},
- 154: {lang: 0x39, script: 0x5, flags: 0x0},
- 155: {lang: 0x21, script: 0x2, flags: 0x1},
- 156: {lang: 0x1f0, script: 0x52, flags: 0x0},
- 157: {lang: 0x1f1, script: 0x52, flags: 0x0},
- 160: {lang: 0x39, script: 0x5, flags: 0x0},
- 161: {lang: 0x1f8, script: 0x41, flags: 0x0},
- 163: {lang: 0x43b, script: 0x52, flags: 0x0},
- 164: {lang: 0x281, script: 0x1e, flags: 0x0},
- 165: {lang: 0x23, script: 0x3, flags: 0x1},
- 167: {lang: 0x26, script: 0x2, flags: 0x1},
- 169: {lang: 0x24b, script: 0x4b, flags: 0x0},
- 170: {lang: 0x24b, script: 0x4b, flags: 0x0},
- 171: {lang: 0x39, script: 0x5, flags: 0x0},
- 173: {lang: 0x3d9, script: 0x1e, flags: 0x0},
- 174: {lang: 0x28, script: 0x2, flags: 0x1},
- 175: {lang: 0x39, script: 0x5, flags: 0x0},
- 177: {lang: 0x109, script: 0x52, flags: 0x0},
- 178: {lang: 0x402, script: 0xc1, flags: 0x0},
- 180: {lang: 0x431, script: 0x52, flags: 0x0},
- 181: {lang: 0x2b7, script: 0x52, flags: 0x0},
- 182: {lang: 0x159, script: 0x52, flags: 0x0},
- 183: {lang: 0x2be, script: 0x52, flags: 0x0},
- 184: {lang: 0x39, script: 0x5, flags: 0x0},
- 185: {lang: 0x2a, script: 0x2, flags: 0x1},
- 186: {lang: 0x159, script: 0x52, flags: 0x0},
- 187: {lang: 0x2c, script: 0x2, flags: 0x1},
- 188: {lang: 0x428, script: 0x52, flags: 0x0},
- 189: {lang: 0x159, script: 0x52, flags: 0x0},
- 190: {lang: 0x2e8, script: 0x52, flags: 0x0},
- 193: {lang: 0x2e, script: 0x2, flags: 0x1},
- 194: {lang: 0x9e, script: 0x52, flags: 0x0},
- 195: {lang: 0x30, script: 0x2, flags: 0x1},
- 196: {lang: 0x32, script: 0x2, flags: 0x1},
- 197: {lang: 0x34, script: 0x2, flags: 0x1},
- 199: {lang: 0x159, script: 0x52, flags: 0x0},
- 200: {lang: 0x36, script: 0x2, flags: 0x1},
- 202: {lang: 0x317, script: 0x52, flags: 0x0},
- 203: {lang: 0x38, script: 0x3, flags: 0x1},
- 204: {lang: 0x124, script: 0xd4, flags: 0x0},
- 206: {lang: 0x139, script: 0x52, flags: 0x0},
- 207: {lang: 0x316, script: 0x52, flags: 0x0},
- 208: {lang: 0x3b7, script: 0x52, flags: 0x0},
- 209: {lang: 0x15, script: 0x52, flags: 0x0},
- 210: {lang: 0x159, script: 0x52, flags: 0x0},
- 211: {lang: 0x1ad, script: 0x52, flags: 0x0},
- 213: {lang: 0x1ad, script: 0x5, flags: 0x2},
- 215: {lang: 0x139, script: 0x52, flags: 0x0},
- 216: {lang: 0x35e, script: 0x52, flags: 0x0},
- 217: {lang: 0x33e, script: 0x52, flags: 0x0},
- 218: {lang: 0x348, script: 0x20, flags: 0x0},
- 224: {lang: 0x39, script: 0x5, flags: 0x0},
- 225: {lang: 0x139, script: 0x52, flags: 0x0},
- 227: {lang: 0x139, script: 0x52, flags: 0x0},
- 228: {lang: 0x159, script: 0x52, flags: 0x0},
- 229: {lang: 0x47c, script: 0x52, flags: 0x0},
- 230: {lang: 0x14e, script: 0x52, flags: 0x0},
- 231: {lang: 0x3b, script: 0x3, flags: 0x1},
- 232: {lang: 0x3e, script: 0x2, flags: 0x1},
- 233: {lang: 0x159, script: 0x52, flags: 0x0},
- 235: {lang: 0x139, script: 0x52, flags: 0x0},
- 236: {lang: 0x39, script: 0x5, flags: 0x0},
- 237: {lang: 0x3b7, script: 0x52, flags: 0x0},
- 239: {lang: 0x399, script: 0x52, flags: 0x0},
- 240: {lang: 0x18e, script: 0x52, flags: 0x0},
- 242: {lang: 0x39, script: 0x5, flags: 0x0},
- 257: {lang: 0x159, script: 0x52, flags: 0x0},
- 259: {lang: 0x40, script: 0x2, flags: 0x1},
- 260: {lang: 0x428, script: 0x1e, flags: 0x0},
- 261: {lang: 0x42, script: 0x2, flags: 0x1},
- 262: {lang: 0x3dc, script: 0x52, flags: 0x0},
- 263: {lang: 0x39, script: 0x5, flags: 0x0},
- 265: {lang: 0x159, script: 0x52, flags: 0x0},
- 266: {lang: 0x39, script: 0x5, flags: 0x0},
- 267: {lang: 0x44, script: 0x2, flags: 0x1},
- 270: {lang: 0x40c, script: 0x52, flags: 0x0},
- 271: {lang: 0x33e, script: 0x52, flags: 0x0},
- 272: {lang: 0x46, script: 0x2, flags: 0x1},
- 274: {lang: 0x1f1, script: 0x52, flags: 0x0},
- 275: {lang: 0x159, script: 0x52, flags: 0x0},
- 276: {lang: 0x41f, script: 0x52, flags: 0x0},
- 277: {lang: 0x35e, script: 0x52, flags: 0x0},
- 279: {lang: 0x3b7, script: 0x52, flags: 0x0},
- 281: {lang: 0x139, script: 0x52, flags: 0x0},
- 283: {lang: 0x48, script: 0x2, flags: 0x1},
- 287: {lang: 0x159, script: 0x52, flags: 0x0},
- 288: {lang: 0x159, script: 0x52, flags: 0x0},
- 289: {lang: 0x4a, script: 0x2, flags: 0x1},
- 290: {lang: 0x4c, script: 0x3, flags: 0x1},
- 291: {lang: 0x4f, script: 0x2, flags: 0x1},
- 292: {lang: 0x46d, script: 0x52, flags: 0x0},
- 293: {lang: 0x3b7, script: 0x52, flags: 0x0},
- 294: {lang: 0x46c, script: 0x52, flags: 0x0},
- 295: {lang: 0x51, script: 0x2, flags: 0x1},
- 296: {lang: 0x478, script: 0x52, flags: 0x0},
- 298: {lang: 0x53, script: 0x4, flags: 0x1},
- 300: {lang: 0x496, script: 0x52, flags: 0x0},
- 301: {lang: 0x57, script: 0x2, flags: 0x1},
- 302: {lang: 0x43b, script: 0x52, flags: 0x0},
- 303: {lang: 0x59, script: 0x3, flags: 0x1},
- 304: {lang: 0x43b, script: 0x52, flags: 0x0},
- 308: {lang: 0x508, script: 0x37, flags: 0x2},
- 309: {lang: 0x139, script: 0x52, flags: 0x0},
- 310: {lang: 0x4b2, script: 0x52, flags: 0x0},
- 311: {lang: 0x1f1, script: 0x52, flags: 0x0},
- 314: {lang: 0x139, script: 0x52, flags: 0x0},
- 317: {lang: 0x4b9, script: 0x52, flags: 0x0},
- 318: {lang: 0x89, script: 0x52, flags: 0x0},
- 319: {lang: 0x159, script: 0x52, flags: 0x0},
- 321: {lang: 0x411, script: 0x52, flags: 0x0},
- 332: {lang: 0x5c, script: 0x2, flags: 0x1},
- 349: {lang: 0x39, script: 0x5, flags: 0x0},
- 350: {lang: 0x5e, script: 0x2, flags: 0x1},
- 355: {lang: 0x419, script: 0x52, flags: 0x0},
-}
-
-// likelyRegionList holds lists info associated with likelyRegion.
-// Size: 384 bytes, 96 elements
-var likelyRegionList = [96]likelyLangScript{
- 0: {lang: 0x143, script: 0x5, flags: 0x0},
- 1: {lang: 0x46c, script: 0x52, flags: 0x0},
- 2: {lang: 0x427, script: 0x52, flags: 0x0},
- 3: {lang: 0x2f6, script: 0x1e, flags: 0x0},
- 4: {lang: 0x1d0, script: 0x8, flags: 0x0},
- 5: {lang: 0x26b, script: 0x52, flags: 0x0},
- 6: {lang: 0xb5, script: 0x52, flags: 0x0},
- 7: {lang: 0x428, script: 0x1e, flags: 0x0},
- 8: {lang: 0x129, script: 0xd6, flags: 0x0},
- 9: {lang: 0x348, script: 0x20, flags: 0x0},
- 10: {lang: 0x51f, script: 0x34, flags: 0x0},
- 11: {lang: 0x4a2, script: 0x5, flags: 0x0},
- 12: {lang: 0x515, script: 0x35, flags: 0x0},
- 13: {lang: 0x519, script: 0x52, flags: 0x0},
- 14: {lang: 0x291, script: 0xd5, flags: 0x0},
- 15: {lang: 0x131, script: 0x2d, flags: 0x0},
- 16: {lang: 0x480, script: 0x52, flags: 0x0},
- 17: {lang: 0x39, script: 0x5, flags: 0x0},
- 18: {lang: 0x159, script: 0x52, flags: 0x0},
- 19: {lang: 0x26, script: 0x27, flags: 0x0},
- 20: {lang: 0x134, script: 0x52, flags: 0x0},
- 21: {lang: 0x261, script: 0x5, flags: 0x2},
- 22: {lang: 0x508, script: 0x37, flags: 0x2},
- 23: {lang: 0x208, script: 0x29, flags: 0x0},
- 24: {lang: 0x5, script: 0x1e, flags: 0x0},
- 25: {lang: 0x26b, script: 0x52, flags: 0x0},
- 26: {lang: 0x131, script: 0x2d, flags: 0x0},
- 27: {lang: 0x2f6, script: 0x1e, flags: 0x0},
- 28: {lang: 0x1da, script: 0x52, flags: 0x0},
- 29: {lang: 0x316, script: 0x5, flags: 0x0},
- 30: {lang: 0x1b7, script: 0x20, flags: 0x0},
- 31: {lang: 0x4aa, script: 0x5, flags: 0x0},
- 32: {lang: 0x22e, script: 0x6b, flags: 0x0},
- 33: {lang: 0x143, script: 0x5, flags: 0x0},
- 34: {lang: 0x46c, script: 0x52, flags: 0x0},
- 35: {lang: 0x242, script: 0x46, flags: 0x0},
- 36: {lang: 0xe4, script: 0x5, flags: 0x0},
- 37: {lang: 0x21e, script: 0xd5, flags: 0x0},
- 38: {lang: 0x39, script: 0x5, flags: 0x0},
- 39: {lang: 0x159, script: 0x52, flags: 0x0},
- 40: {lang: 0x2af, script: 0x4f, flags: 0x0},
- 41: {lang: 0x21e, script: 0xd5, flags: 0x0},
- 42: {lang: 0x39, script: 0x5, flags: 0x0},
- 43: {lang: 0x159, script: 0x52, flags: 0x0},
- 44: {lang: 0x3d3, script: 0x52, flags: 0x0},
- 45: {lang: 0x4a4, script: 0x1e, flags: 0x0},
- 46: {lang: 0x2f6, script: 0x1e, flags: 0x0},
- 47: {lang: 0x427, script: 0x52, flags: 0x0},
- 48: {lang: 0x328, script: 0x6b, flags: 0x0},
- 49: {lang: 0x20b, script: 0x52, flags: 0x0},
- 50: {lang: 0x302, script: 0x1e, flags: 0x0},
- 51: {lang: 0x23a, script: 0x5, flags: 0x0},
- 52: {lang: 0x51f, script: 0x35, flags: 0x0},
- 53: {lang: 0x3b7, script: 0x52, flags: 0x0},
- 54: {lang: 0x39, script: 0x5, flags: 0x0},
- 55: {lang: 0x159, script: 0x52, flags: 0x0},
- 56: {lang: 0x2e4, script: 0x52, flags: 0x0},
- 57: {lang: 0x4aa, script: 0x5, flags: 0x0},
- 58: {lang: 0x87, script: 0x20, flags: 0x0},
- 59: {lang: 0x4aa, script: 0x5, flags: 0x0},
- 60: {lang: 0x4aa, script: 0x5, flags: 0x0},
- 61: {lang: 0xbc, script: 0x20, flags: 0x0},
- 62: {lang: 0x3aa, script: 0x52, flags: 0x0},
- 63: {lang: 0x70, script: 0x1e, flags: 0x0},
- 64: {lang: 0x3d3, script: 0x52, flags: 0x0},
- 65: {lang: 0x7d, script: 0x1e, flags: 0x0},
- 66: {lang: 0x3d9, script: 0x1e, flags: 0x0},
- 67: {lang: 0x25e, script: 0x52, flags: 0x0},
- 68: {lang: 0x43a, script: 0x52, flags: 0x0},
- 69: {lang: 0x508, script: 0x37, flags: 0x0},
- 70: {lang: 0x408, script: 0x52, flags: 0x0},
- 71: {lang: 0x4a4, script: 0x1e, flags: 0x0},
- 72: {lang: 0x39, script: 0x5, flags: 0x0},
- 73: {lang: 0x159, script: 0x52, flags: 0x0},
- 74: {lang: 0x159, script: 0x52, flags: 0x0},
- 75: {lang: 0x34, script: 0x5, flags: 0x0},
- 76: {lang: 0x461, script: 0xd5, flags: 0x0},
- 77: {lang: 0x2e3, script: 0x5, flags: 0x0},
- 78: {lang: 0x306, script: 0x6b, flags: 0x0},
- 79: {lang: 0x45d, script: 0x1e, flags: 0x0},
- 80: {lang: 0x143, script: 0x5, flags: 0x0},
- 81: {lang: 0x39, script: 0x5, flags: 0x0},
- 82: {lang: 0x159, script: 0x52, flags: 0x0},
- 83: {lang: 0x480, script: 0x52, flags: 0x0},
- 84: {lang: 0x57, script: 0x5, flags: 0x0},
- 85: {lang: 0x211, script: 0x1e, flags: 0x0},
- 86: {lang: 0x80, script: 0x2d, flags: 0x0},
- 87: {lang: 0x51f, script: 0x35, flags: 0x0},
- 88: {lang: 0x482, script: 0x52, flags: 0x0},
- 89: {lang: 0x4a4, script: 0x1e, flags: 0x0},
- 90: {lang: 0x508, script: 0x37, flags: 0x0},
- 91: {lang: 0x3aa, script: 0x52, flags: 0x0},
- 92: {lang: 0x427, script: 0x52, flags: 0x0},
- 93: {lang: 0x428, script: 0x1e, flags: 0x0},
- 94: {lang: 0x159, script: 0x52, flags: 0x0},
- 95: {lang: 0x43c, script: 0x5, flags: 0x0},
-}
-
-type likelyTag struct {
- lang uint16
- region uint16
- script uint8
-}
-
-// Size: 192 bytes, 32 elements
-var likelyRegionGroup = [32]likelyTag{
- 1: {lang: 0x134, region: 0xd5, script: 0x52},
- 2: {lang: 0x134, region: 0x134, script: 0x52},
- 3: {lang: 0x3b7, region: 0x40, script: 0x52},
- 4: {lang: 0x134, region: 0x2e, script: 0x52},
- 5: {lang: 0x134, region: 0xd5, script: 0x52},
- 6: {lang: 0x139, region: 0xce, script: 0x52},
- 7: {lang: 0x43b, region: 0x12e, script: 0x52},
- 8: {lang: 0x39, region: 0x6a, script: 0x5},
- 9: {lang: 0x43b, region: 0x4a, script: 0x52},
- 10: {lang: 0x134, region: 0x160, script: 0x52},
- 11: {lang: 0x134, region: 0x134, script: 0x52},
- 12: {lang: 0x134, region: 0x134, script: 0x52},
- 13: {lang: 0x139, region: 0x58, script: 0x52},
- 14: {lang: 0x51f, region: 0x52, script: 0x34},
- 15: {lang: 0x1b7, region: 0x98, script: 0x20},
- 16: {lang: 0x1da, region: 0x94, script: 0x52},
- 17: {lang: 0x1f1, region: 0x9d, script: 0x52},
- 18: {lang: 0x134, region: 0x2e, script: 0x52},
- 19: {lang: 0x134, region: 0xe5, script: 0x52},
- 20: {lang: 0x134, region: 0x89, script: 0x52},
- 21: {lang: 0x411, region: 0x141, script: 0x52},
- 22: {lang: 0x51f, region: 0x52, script: 0x34},
- 23: {lang: 0x4b2, region: 0x136, script: 0x52},
- 24: {lang: 0x39, region: 0x107, script: 0x5},
- 25: {lang: 0x3d9, region: 0x105, script: 0x1e},
- 26: {lang: 0x3d9, region: 0x105, script: 0x1e},
- 27: {lang: 0x134, region: 0x7a, script: 0x52},
- 28: {lang: 0x109, region: 0x5f, script: 0x52},
- 29: {lang: 0x139, region: 0x1e, script: 0x52},
- 30: {lang: 0x134, region: 0x99, script: 0x52},
- 31: {lang: 0x134, region: 0x7a, script: 0x52},
-}
+var paradigmLocales = [][3]uint16{ // 3 elements
+ 0: [3]uint16{0x139, 0x0, 0x7b},
+ 1: [3]uint16{0x13e, 0x0, 0x1f},
+ 2: [3]uint16{0x3c0, 0x41, 0xee},
+} // Size: 42 bytes
type mutualIntelligibility struct {
- want uint16
- have uint16
- conf uint8
- oneway bool
+ want uint16
+ have uint16
+ distance uint8
+ oneway bool
}
-
type scriptIntelligibility struct {
- lang uint16
- want uint8
- have uint8
- conf uint8
+ wantLang uint16
+ haveLang uint16
+ wantScript uint8
+ haveScript uint8
+ distance uint8
+}
+type regionIntelligibility struct {
+ lang uint16
+ script uint8
+ group uint8
+ distance uint8
}
// matchLang holds pairs of langIDs of base languages that are typically
// mutually intelligible. Each pair is associated with a confidence and
// whether the intelligibility goes one or both ways.
-// Size: 708 bytes, 118 elements
-var matchLang = [118]mutualIntelligibility{
- 0: {want: 0x366, have: 0x33e, conf: 0x2, oneway: false},
- 1: {want: 0x26b, have: 0xe7, conf: 0x2, oneway: false},
- 2: {want: 0x1ca, have: 0xb5, conf: 0x2, oneway: false},
- 3: {want: 0x3fd, have: 0xb5, conf: 0x2, oneway: false},
- 4: {want: 0x428, have: 0xb5, conf: 0x2, oneway: false},
- 5: {want: 0x3fd, have: 0x1ca, conf: 0x2, oneway: false},
- 6: {want: 0x428, have: 0x1ca, conf: 0x2, oneway: false},
- 7: {want: 0x3fd, have: 0x428, conf: 0x2, oneway: false},
- 8: {want: 0x430, have: 0x1, conf: 0x2, oneway: false},
- 9: {want: 0x19c, have: 0x109, conf: 0x2, oneway: true},
- 10: {want: 0x28c, have: 0x109, conf: 0x2, oneway: true},
- 11: {want: 0xfd, have: 0x366, conf: 0x2, oneway: false},
- 12: {want: 0xfd, have: 0x33e, conf: 0x2, oneway: false},
- 13: {want: 0xe7, have: 0x26b, conf: 0x2, oneway: false},
- 14: {want: 0x5, have: 0x3d9, conf: 0x2, oneway: true},
- 15: {want: 0xc, have: 0x134, conf: 0x2, oneway: true},
- 16: {want: 0x15, have: 0x35e, conf: 0x2, oneway: true},
- 17: {want: 0x20, have: 0x134, conf: 0x2, oneway: true},
- 18: {want: 0x55, have: 0x139, conf: 0x2, oneway: true},
- 19: {want: 0x57, have: 0x3d9, conf: 0x2, oneway: true},
- 20: {want: 0x70, have: 0x3d9, conf: 0x2, oneway: true},
- 21: {want: 0x74, have: 0x134, conf: 0x2, oneway: true},
- 22: {want: 0x81, have: 0x1b7, conf: 0x2, oneway: true},
- 23: {want: 0xa3, have: 0x134, conf: 0x2, oneway: true},
- 24: {want: 0xb0, have: 0x159, conf: 0x2, oneway: true},
- 25: {want: 0xdb, have: 0x14e, conf: 0x2, oneway: true},
- 26: {want: 0xe3, have: 0x134, conf: 0x2, oneway: true},
- 27: {want: 0xe7, have: 0x39, conf: 0x2, oneway: true},
- 28: {want: 0xed, have: 0x159, conf: 0x2, oneway: true},
- 29: {want: 0xf5, have: 0x159, conf: 0x2, oneway: true},
- 30: {want: 0xfc, have: 0x134, conf: 0x2, oneway: true},
- 31: {want: 0x12c, have: 0x134, conf: 0x2, oneway: true},
- 32: {want: 0x137, have: 0x134, conf: 0x2, oneway: true},
- 33: {want: 0x13b, have: 0x14c, conf: 0x2, oneway: true},
- 34: {want: 0x140, have: 0x139, conf: 0x2, oneway: true},
- 35: {want: 0x153, have: 0xfd, conf: 0x2, oneway: true},
- 36: {want: 0x168, have: 0x35e, conf: 0x2, oneway: true},
- 37: {want: 0x169, have: 0x134, conf: 0x2, oneway: true},
- 38: {want: 0x16a, have: 0x134, conf: 0x2, oneway: true},
- 39: {want: 0x178, have: 0x134, conf: 0x2, oneway: true},
- 40: {want: 0x18a, have: 0x139, conf: 0x2, oneway: true},
- 41: {want: 0x18e, have: 0x139, conf: 0x2, oneway: true},
- 42: {want: 0x19d, have: 0x1b7, conf: 0x2, oneway: true},
- 43: {want: 0x1ad, have: 0x134, conf: 0x2, oneway: true},
- 44: {want: 0x1b1, have: 0x134, conf: 0x2, oneway: true},
- 45: {want: 0x1cd, have: 0x159, conf: 0x2, oneway: true},
- 46: {want: 0x1d0, have: 0x3d9, conf: 0x2, oneway: true},
- 47: {want: 0x1d2, have: 0x134, conf: 0x2, oneway: true},
- 48: {want: 0x1df, have: 0x134, conf: 0x2, oneway: true},
- 49: {want: 0x1f0, have: 0x134, conf: 0x2, oneway: true},
- 50: {want: 0x206, have: 0x1da, conf: 0x2, oneway: true},
- 51: {want: 0x208, have: 0x134, conf: 0x2, oneway: true},
- 52: {want: 0x225, have: 0x159, conf: 0x2, oneway: true},
- 53: {want: 0x23a, have: 0x3d9, conf: 0x2, oneway: true},
- 54: {want: 0x242, have: 0x134, conf: 0x2, oneway: true},
- 55: {want: 0x249, have: 0x134, conf: 0x2, oneway: true},
- 56: {want: 0x25c, have: 0x134, conf: 0x2, oneway: true},
- 57: {want: 0x26b, have: 0x480, conf: 0x2, oneway: true},
- 58: {want: 0x281, have: 0x3d9, conf: 0x2, oneway: true},
- 59: {want: 0x285, have: 0x1f1, conf: 0x2, oneway: true},
- 60: {want: 0x29a, have: 0x134, conf: 0x2, oneway: true},
- 61: {want: 0x2ac, have: 0x159, conf: 0x2, oneway: true},
- 62: {want: 0x2af, have: 0x134, conf: 0x2, oneway: true},
- 63: {want: 0x2b5, have: 0x134, conf: 0x2, oneway: true},
- 64: {want: 0x2ba, have: 0x159, conf: 0x2, oneway: true},
- 65: {want: 0x2e4, have: 0x134, conf: 0x2, oneway: true},
- 66: {want: 0x2e8, have: 0x159, conf: 0x2, oneway: true},
- 67: {want: 0x2f1, have: 0x134, conf: 0x2, oneway: true},
- 68: {want: 0x2f6, have: 0x7d, conf: 0x2, oneway: true},
- 69: {want: 0x2fb, have: 0x134, conf: 0x2, oneway: true},
- 70: {want: 0x302, have: 0x3d9, conf: 0x2, oneway: true},
- 71: {want: 0x312, have: 0x1b7, conf: 0x2, oneway: true},
- 72: {want: 0x316, have: 0x1da, conf: 0x2, oneway: true},
- 73: {want: 0x317, have: 0x134, conf: 0x2, oneway: true},
- 74: {want: 0x328, have: 0x134, conf: 0x2, oneway: true},
- 75: {want: 0x348, have: 0x134, conf: 0x2, oneway: true},
- 76: {want: 0x361, have: 0x33e, conf: 0x2, oneway: false},
- 77: {want: 0x361, have: 0x366, conf: 0x2, oneway: true},
- 78: {want: 0x371, have: 0x134, conf: 0x2, oneway: true},
- 79: {want: 0x37e, have: 0x134, conf: 0x2, oneway: true},
- 80: {want: 0x380, have: 0x134, conf: 0x2, oneway: true},
- 81: {want: 0x382, have: 0x159, conf: 0x2, oneway: true},
- 82: {want: 0x387, have: 0x134, conf: 0x2, oneway: true},
- 83: {want: 0x38c, have: 0x134, conf: 0x2, oneway: true},
- 84: {want: 0x394, have: 0x134, conf: 0x2, oneway: true},
- 85: {want: 0x39c, have: 0x134, conf: 0x2, oneway: true},
- 86: {want: 0x3b5, have: 0x134, conf: 0x2, oneway: true},
- 87: {want: 0x3bb, have: 0x139, conf: 0x2, oneway: true},
- 88: {want: 0x3cb, have: 0x109, conf: 0x2, oneway: true},
- 89: {want: 0x3d0, have: 0x134, conf: 0x2, oneway: true},
- 90: {want: 0x3dc, have: 0x159, conf: 0x2, oneway: true},
- 91: {want: 0x3e0, have: 0x1b7, conf: 0x2, oneway: true},
- 92: {want: 0x3f0, have: 0x134, conf: 0x2, oneway: true},
- 93: {want: 0x402, have: 0x134, conf: 0x2, oneway: true},
- 94: {want: 0x419, have: 0x134, conf: 0x2, oneway: true},
- 95: {want: 0x41f, have: 0x134, conf: 0x2, oneway: true},
- 96: {want: 0x427, have: 0x134, conf: 0x2, oneway: true},
- 97: {want: 0x431, have: 0x134, conf: 0x2, oneway: true},
- 98: {want: 0x434, have: 0x1da, conf: 0x2, oneway: true},
- 99: {want: 0x43b, have: 0x134, conf: 0x2, oneway: true},
- 100: {want: 0x446, have: 0x134, conf: 0x2, oneway: true},
- 101: {want: 0x457, have: 0x134, conf: 0x2, oneway: true},
- 102: {want: 0x45d, have: 0x3d9, conf: 0x2, oneway: true},
- 103: {want: 0x465, have: 0x134, conf: 0x2, oneway: true},
- 104: {want: 0x46c, have: 0x3d9, conf: 0x2, oneway: true},
- 105: {want: 0x3878, have: 0x134, conf: 0x2, oneway: true},
- 106: {want: 0x476, have: 0x134, conf: 0x2, oneway: true},
- 107: {want: 0x478, have: 0x134, conf: 0x2, oneway: true},
- 108: {want: 0x48a, have: 0x3d9, conf: 0x2, oneway: true},
- 109: {want: 0x493, have: 0x134, conf: 0x2, oneway: true},
- 110: {want: 0x4a2, have: 0x51f, conf: 0x2, oneway: true},
- 111: {want: 0x4aa, have: 0x134, conf: 0x2, oneway: true},
- 112: {want: 0x4b2, have: 0x3d9, conf: 0x2, oneway: true},
- 113: {want: 0x4db, have: 0x159, conf: 0x2, oneway: true},
- 114: {want: 0x4e8, have: 0x134, conf: 0x2, oneway: true},
- 115: {want: 0x508, have: 0x134, conf: 0x2, oneway: true},
- 116: {want: 0x50e, have: 0x134, conf: 0x2, oneway: true},
- 117: {want: 0x524, have: 0x134, conf: 0x2, oneway: true},
-}
+var matchLang = []mutualIntelligibility{ // 113 elements
+ 0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false},
+ 1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false},
+ 2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false},
+ 3: {want: 0x407, have: 0x432, distance: 0x4, oneway: false},
+ 4: {want: 0x43a, have: 0x1, distance: 0x4, oneway: false},
+ 5: {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true},
+ 6: {want: 0x295, have: 0x10d, distance: 0x4, oneway: true},
+ 7: {want: 0x101, have: 0x36f, distance: 0x8, oneway: false},
+ 8: {want: 0x101, have: 0x347, distance: 0x8, oneway: false},
+ 9: {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true},
+ 10: {want: 0xd, have: 0x139, distance: 0xa, oneway: true},
+ 11: {want: 0x16, have: 0x367, distance: 0xa, oneway: true},
+ 12: {want: 0x21, have: 0x139, distance: 0xa, oneway: true},
+ 13: {want: 0x56, have: 0x13e, distance: 0xa, oneway: true},
+ 14: {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true},
+ 15: {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true},
+ 16: {want: 0x75, have: 0x139, distance: 0xa, oneway: true},
+ 17: {want: 0x82, have: 0x1be, distance: 0xa, oneway: true},
+ 18: {want: 0xa5, have: 0x139, distance: 0xa, oneway: true},
+ 19: {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true},
+ 20: {want: 0xdd, have: 0x153, distance: 0xa, oneway: true},
+ 21: {want: 0xe5, have: 0x139, distance: 0xa, oneway: true},
+ 22: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true},
+ 23: {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true},
+ 24: {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true},
+ 25: {want: 0x100, have: 0x139, distance: 0xa, oneway: true},
+ 26: {want: 0x130, have: 0x139, distance: 0xa, oneway: true},
+ 27: {want: 0x13c, have: 0x139, distance: 0xa, oneway: true},
+ 28: {want: 0x140, have: 0x151, distance: 0xa, oneway: true},
+ 29: {want: 0x145, have: 0x13e, distance: 0xa, oneway: true},
+ 30: {want: 0x158, have: 0x101, distance: 0xa, oneway: true},
+ 31: {want: 0x16d, have: 0x367, distance: 0xa, oneway: true},
+ 32: {want: 0x16e, have: 0x139, distance: 0xa, oneway: true},
+ 33: {want: 0x16f, have: 0x139, distance: 0xa, oneway: true},
+ 34: {want: 0x17e, have: 0x139, distance: 0xa, oneway: true},
+ 35: {want: 0x190, have: 0x13e, distance: 0xa, oneway: true},
+ 36: {want: 0x194, have: 0x13e, distance: 0xa, oneway: true},
+ 37: {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true},
+ 38: {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true},
+ 39: {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true},
+ 40: {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true},
+ 41: {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true},
+ 42: {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true},
+ 43: {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true},
+ 44: {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true},
+ 45: {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true},
+ 46: {want: 0x210, have: 0x139, distance: 0xa, oneway: true},
+ 47: {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true},
+ 48: {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true},
+ 49: {want: 0x24a, have: 0x139, distance: 0xa, oneway: true},
+ 50: {want: 0x251, have: 0x139, distance: 0xa, oneway: true},
+ 51: {want: 0x265, have: 0x139, distance: 0xa, oneway: true},
+ 52: {want: 0x274, have: 0x48a, distance: 0xa, oneway: true},
+ 53: {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true},
+ 54: {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true},
+ 55: {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true},
+ 56: {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true},
+ 57: {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true},
+ 58: {want: 0x2be, have: 0x139, distance: 0xa, oneway: true},
+ 59: {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true},
+ 60: {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true},
+ 61: {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true},
+ 62: {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true},
+ 63: {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true},
+ 64: {want: 0x304, have: 0x139, distance: 0xa, oneway: true},
+ 65: {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true},
+ 66: {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true},
+ 67: {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true},
+ 68: {want: 0x320, have: 0x139, distance: 0xa, oneway: true},
+ 69: {want: 0x331, have: 0x139, distance: 0xa, oneway: true},
+ 70: {want: 0x351, have: 0x139, distance: 0xa, oneway: true},
+ 71: {want: 0x36a, have: 0x347, distance: 0xa, oneway: false},
+ 72: {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true},
+ 73: {want: 0x37a, have: 0x139, distance: 0xa, oneway: true},
+ 74: {want: 0x387, have: 0x139, distance: 0xa, oneway: true},
+ 75: {want: 0x389, have: 0x139, distance: 0xa, oneway: true},
+ 76: {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true},
+ 77: {want: 0x390, have: 0x139, distance: 0xa, oneway: true},
+ 78: {want: 0x395, have: 0x139, distance: 0xa, oneway: true},
+ 79: {want: 0x39d, have: 0x139, distance: 0xa, oneway: true},
+ 80: {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true},
+ 81: {want: 0x3be, have: 0x139, distance: 0xa, oneway: true},
+ 82: {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true},
+ 83: {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true},
+ 84: {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true},
+ 85: {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true},
+ 86: {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true},
+ 87: {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true},
+ 88: {want: 0x40c, have: 0x139, distance: 0xa, oneway: true},
+ 89: {want: 0x423, have: 0x139, distance: 0xa, oneway: true},
+ 90: {want: 0x429, have: 0x139, distance: 0xa, oneway: true},
+ 91: {want: 0x431, have: 0x139, distance: 0xa, oneway: true},
+ 92: {want: 0x43b, have: 0x139, distance: 0xa, oneway: true},
+ 93: {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true},
+ 94: {want: 0x445, have: 0x139, distance: 0xa, oneway: true},
+ 95: {want: 0x450, have: 0x139, distance: 0xa, oneway: true},
+ 96: {want: 0x461, have: 0x139, distance: 0xa, oneway: true},
+ 97: {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true},
+ 98: {want: 0x46f, have: 0x139, distance: 0xa, oneway: true},
+ 99: {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true},
+ 100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true},
+ 101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true},
+ 102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true},
+ 103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true},
+ 104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true},
+ 105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true},
+ 106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true},
+ 107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true},
+ 108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true},
+ 109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true},
+ 110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true},
+ 111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true},
+ 112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true},
+} // Size: 702 bytes
// matchScript holds pairs of scriptIDs where readers of one script
// can typically also read the other. Each is associated with a confidence.
-// Size: 24 bytes, 4 elements
-var matchScript = [4]scriptIntelligibility{
- 0: {lang: 0x428, want: 0x52, have: 0x1e, conf: 0x2},
- 1: {lang: 0x428, want: 0x1e, have: 0x52, conf: 0x2},
- 2: {lang: 0x0, want: 0x34, have: 0x35, conf: 0x1},
- 3: {lang: 0x0, want: 0x35, have: 0x34, conf: 0x1},
-}
-
-// Size: 128 bytes, 32 elements
-var regionContainment = [32]uint32{
- 0xffffffff, 0x000007a2, 0x00003044, 0x00000008,
- 0x403c0010, 0x00000020, 0x00000040, 0x00000080,
- 0x00000100, 0x00000200, 0x00000400, 0x2000384c,
- 0x00001000, 0x00002000, 0x00004000, 0x00008000,
- 0x00010000, 0x00020000, 0x00040000, 0x00080000,
- 0x00100000, 0x00200000, 0x01c1c000, 0x00800000,
- 0x01000000, 0x1e020000, 0x04000000, 0x08000000,
- 0x10000000, 0x20002048, 0x40000000, 0x80000000,
-}
-
-// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
-// where each set holds all groupings that are directly connected in a region
-// containment graph.
-// Size: 357 bytes, 357 elements
-var regionInclusion = [357]uint8{
- // Entry 0 - 3F
- 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
- 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
- 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
- 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x20,
- 0x21, 0x22, 0x23, 0x24, 0x25, 0x25, 0x22, 0x23,
- 0x25, 0x26, 0x21, 0x27, 0x28, 0x29, 0x2a, 0x25,
- 0x2b, 0x23, 0x22, 0x25, 0x24, 0x29, 0x2c, 0x2d,
- 0x23, 0x2e, 0x2c, 0x25, 0x2f, 0x30, 0x27, 0x25,
- // Entry 40 - 7F
- 0x27, 0x25, 0x24, 0x30, 0x21, 0x31, 0x32, 0x33,
- 0x2f, 0x21, 0x26, 0x26, 0x26, 0x34, 0x2c, 0x28,
- 0x27, 0x26, 0x35, 0x27, 0x21, 0x33, 0x22, 0x20,
- 0x25, 0x2c, 0x25, 0x21, 0x36, 0x2d, 0x34, 0x29,
- 0x21, 0x2e, 0x37, 0x25, 0x25, 0x20, 0x38, 0x38,
- 0x27, 0x37, 0x38, 0x38, 0x2e, 0x39, 0x2e, 0x1f,
- 0x20, 0x37, 0x3a, 0x27, 0x3b, 0x2b, 0x20, 0x29,
- 0x34, 0x26, 0x37, 0x25, 0x23, 0x27, 0x2b, 0x2c,
- // Entry 80 - BF
- 0x22, 0x2f, 0x2c, 0x2c, 0x25, 0x26, 0x39, 0x21,
- 0x33, 0x3b, 0x2c, 0x27, 0x35, 0x21, 0x33, 0x39,
- 0x25, 0x2d, 0x20, 0x38, 0x30, 0x37, 0x23, 0x2b,
- 0x24, 0x21, 0x23, 0x24, 0x2b, 0x39, 0x2b, 0x25,
- 0x23, 0x35, 0x20, 0x2e, 0x3c, 0x30, 0x3b, 0x2e,
- 0x25, 0x35, 0x35, 0x23, 0x25, 0x3c, 0x30, 0x23,
- 0x25, 0x34, 0x24, 0x2c, 0x31, 0x37, 0x29, 0x37,
- 0x38, 0x38, 0x34, 0x32, 0x22, 0x25, 0x2e, 0x3b,
- // Entry C0 - FF
- 0x20, 0x22, 0x2c, 0x30, 0x35, 0x35, 0x3b, 0x25,
- 0x2c, 0x25, 0x39, 0x2e, 0x24, 0x2e, 0x33, 0x30,
- 0x2e, 0x31, 0x3a, 0x2c, 0x2a, 0x2c, 0x20, 0x33,
- 0x29, 0x2b, 0x24, 0x20, 0x3b, 0x23, 0x28, 0x2a,
- 0x23, 0x33, 0x20, 0x27, 0x28, 0x3a, 0x30, 0x24,
- 0x2d, 0x2f, 0x28, 0x25, 0x23, 0x39, 0x20, 0x3b,
- 0x27, 0x20, 0x23, 0x20, 0x20, 0x1e, 0x20, 0x20,
- 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20,
- // Entry 100 - 13F
- 0x20, 0x2e, 0x20, 0x2d, 0x22, 0x32, 0x2e, 0x23,
- 0x3a, 0x2e, 0x38, 0x37, 0x30, 0x2c, 0x39, 0x2b,
- 0x2d, 0x2c, 0x22, 0x2c, 0x2e, 0x27, 0x2e, 0x26,
- 0x32, 0x33, 0x25, 0x23, 0x31, 0x21, 0x25, 0x26,
- 0x21, 0x2c, 0x30, 0x3c, 0x28, 0x30, 0x3c, 0x38,
- 0x28, 0x30, 0x23, 0x25, 0x28, 0x35, 0x2e, 0x32,
- 0x2e, 0x20, 0x21, 0x20, 0x2f, 0x27, 0x3c, 0x22,
- 0x25, 0x20, 0x27, 0x25, 0x25, 0x30, 0x3a, 0x28,
- // Entry 140 - 17F
- 0x20, 0x28, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20,
- 0x20, 0x20, 0x20, 0x20, 0x22, 0x20, 0x20, 0x20,
- 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20,
- 0x20, 0x20, 0x20, 0x20, 0x23, 0x23, 0x2e, 0x22,
- 0x31, 0x2e, 0x26, 0x2e, 0x20,
-}
-
-// regionInclusionBits is an array of bit vectors where every vector represents
-// a set of region groupings. These sets are used to compute the distance
-// between two regions for the purpose of language matching.
-// Size: 288 bytes, 72 elements
-var regionInclusionBits = [72]uint32{
- // Entry 0 - 1F
- 0x82400813, 0x000007a3, 0x00003844, 0x20000808,
- 0x403c0011, 0x00000022, 0x20000844, 0x00000082,
- 0x00000102, 0x00000202, 0x00000402, 0x2000384d,
- 0x00001804, 0x20002804, 0x00404000, 0x00408000,
- 0x00410000, 0x02020000, 0x00040010, 0x00080010,
- 0x00100010, 0x00200010, 0x01c1c001, 0x00c00000,
- 0x01400000, 0x1e020001, 0x06000000, 0x0a000000,
- 0x12000000, 0x20002848, 0x40000010, 0x80000001,
- // Entry 20 - 3F
- 0x00000001, 0x40000000, 0x00020000, 0x01000000,
- 0x00008000, 0x00002000, 0x00000200, 0x00000008,
- 0x00200000, 0x90000000, 0x00040000, 0x08000000,
- 0x00000020, 0x84000000, 0x00000080, 0x00001000,
- 0x00010000, 0x00000400, 0x04000000, 0x00000040,
- 0x10000000, 0x00004000, 0x81000000, 0x88000000,
- 0x00000100, 0x80020000, 0x00080000, 0x00100000,
- 0x00800000, 0xffffffff, 0x82400fb3, 0xc27c0813,
- // Entry 40 - 5F
- 0xa240385f, 0x83c1c813, 0x9e420813, 0x92000001,
- 0x86000001, 0x81400001, 0x8a000001, 0x82020001,
-}
-
-// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
-// all groups that are reachable from the groups set in the respective entry.
-// Size: 72 bytes, 72 elements
-var regionInclusionNext = [72]uint8{
- // Entry 0 - 3F
- 0x3d, 0x3e, 0x0b, 0x0b, 0x3f, 0x01, 0x0b, 0x01,
- 0x01, 0x01, 0x01, 0x40, 0x0b, 0x0b, 0x16, 0x16,
- 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x41, 0x16,
- 0x16, 0x42, 0x19, 0x19, 0x19, 0x0b, 0x04, 0x00,
- 0x00, 0x1e, 0x11, 0x18, 0x0f, 0x0d, 0x09, 0x03,
- 0x15, 0x43, 0x12, 0x1b, 0x05, 0x44, 0x07, 0x0c,
- 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x45, 0x46,
- 0x08, 0x47, 0x13, 0x14, 0x17, 0x3d, 0x3d, 0x3d,
- // Entry 40 - 7F
- 0x3d, 0x3d, 0x3d, 0x42, 0x42, 0x41, 0x42, 0x42,
-}
-
-type parentRel struct {
- lang uint16
- script uint8
- maxScript uint8
- toRegion uint16
- fromRegion []uint16
-}
-
-// Size: 412 bytes, 5 elements
-var parents = [5]parentRel{
- 0: {lang: 0x134, script: 0x0, maxScript: 0x52, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x24, 0x25, 0x2e, 0x33, 0x35, 0x3c, 0x41, 0x45, 0x47, 0x48, 0x49, 0x4f, 0x51, 0x5b, 0x5c, 0x60, 0x63, 0x6c, 0x72, 0x73, 0x74, 0x7a, 0x7b, 0x7e, 0x7f, 0x80, 0x82, 0x8b, 0x8c, 0x95, 0x96, 0x97, 0x98, 0x99, 0x9e, 0x9f, 0xa3, 0xa6, 0xa8, 0xac, 0xb0, 0xb3, 0xb4, 0xbe, 0xc5, 0xc9, 0xca, 0xcb, 0xcd, 0xcf, 0xd1, 0xd4, 0xd5, 0xdc, 0xde, 0xdf, 0xe5, 0xe6, 0xe7, 0xea, 0xef, 0x106, 0x108, 0x109, 0x10a, 0x10c, 0x10d, 0x111, 0x116, 0x11a, 0x11c, 0x11e, 0x124, 0x128, 0x12b, 0x12c, 0x12e, 0x130, 0x138, 0x13b, 0x13e, 0x141, 0x160, 0x161, 0x163}},
- 1: {lang: 0x134, script: 0x0, maxScript: 0x52, toRegion: 0x1a, fromRegion: []uint16{0x2d, 0x4d, 0x5f, 0x62, 0x71, 0xd8, 0x10b, 0x10e}},
- 2: {lang: 0x139, script: 0x0, maxScript: 0x52, toRegion: 0x1e, fromRegion: []uint16{0x2b, 0x3e, 0x40, 0x50, 0x53, 0x55, 0x58, 0x64, 0x68, 0x88, 0x8e, 0xce, 0xd7, 0xe1, 0xe3, 0xeb, 0xf0, 0x119, 0x134, 0x135, 0x13a}},
- 3: {lang: 0x3b7, script: 0x0, maxScript: 0x52, toRegion: 0xed, fromRegion: []uint16{0x29, 0x4d, 0x59, 0x85, 0x8a, 0xb6, 0xc5, 0xd0, 0x117, 0x125}},
- 4: {lang: 0x51f, script: 0x35, maxScript: 0x35, toRegion: 0x8c, fromRegion: []uint16{0xc5}},
-}
-
-// Total table size 25825 bytes (25KiB); checksum: 4E97CC5E
+var matchScript = []scriptIntelligibility{ // 26 elements
+ 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x57, haveScript: 0x1f, distance: 0x5},
+ 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x1f, haveScript: 0x57, distance: 0x5},
+ 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
+ 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x57, distance: 0xa},
+ 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x1f, distance: 0xa},
+ 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2b, haveScript: 0x57, distance: 0xa},
+ 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4b, haveScript: 0x57, distance: 0xa},
+ 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x57, distance: 0xa},
+ 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x54, haveScript: 0x57, distance: 0xa},
+ 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6b, haveScript: 0x57, distance: 0xa},
+ 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x72, haveScript: 0x57, distance: 0xa},
+ 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x21, haveScript: 0x57, distance: 0xa},
+ 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x7d, haveScript: 0x57, distance: 0xa},
+ 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x33, haveScript: 0x57, distance: 0xa},
+ 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa},
+ 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa},
+ 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xca, haveScript: 0x57, distance: 0xa},
+ 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xd7, haveScript: 0x57, distance: 0xa},
+ 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xda, haveScript: 0x57, distance: 0xa},
+ 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x29, haveScript: 0x57, distance: 0xa},
+ 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
+ 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa},
+ 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
+ 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3b, haveScript: 0x57, distance: 0xa},
+ 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x38, haveScript: 0x39, distance: 0xf},
+ 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x39, haveScript: 0x38, distance: 0x13},
+} // Size: 232 bytes
+
+var matchRegion = []regionIntelligibility{ // 15 elements
+ 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4},
+ 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4},
+ 2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4},
+ 3: {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4},
+ 4: {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4},
+ 5: {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4},
+ 6: {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4},
+ 7: {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4},
+ 8: {lang: 0x529, script: 0x39, group: 0x2, distance: 0x4},
+ 9: {lang: 0x529, script: 0x39, group: 0x82, distance: 0x4},
+ 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5},
+ 11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5},
+ 12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5},
+ 13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5},
+ 14: {lang: 0x529, script: 0x39, group: 0x80, distance: 0x5},
+} // Size: 114 bytes
+
+// Total table size 1471 bytes (1KiB); checksum: 4CB1CD46
diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go
index de30155a2..42ea79266 100644
--- a/vendor/golang.org/x/text/language/tags.go
+++ b/vendor/golang.org/x/text/language/tags.go
@@ -4,6 +4,8 @@
package language
+import "golang.org/x/text/internal/language/compact"
+
// TODO: Various sets of commonly use tags and regions.
// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
@@ -61,83 +63,83 @@ var (
Und Tag = Tag{}
- Afrikaans Tag = Tag{lang: _af} // af
- Amharic Tag = Tag{lang: _am} // am
- Arabic Tag = Tag{lang: _ar} // ar
- ModernStandardArabic Tag = Tag{lang: _ar, region: _001} // ar-001
- Azerbaijani Tag = Tag{lang: _az} // az
- Bulgarian Tag = Tag{lang: _bg} // bg
- Bengali Tag = Tag{lang: _bn} // bn
- Catalan Tag = Tag{lang: _ca} // ca
- Czech Tag = Tag{lang: _cs} // cs
- Danish Tag = Tag{lang: _da} // da
- German Tag = Tag{lang: _de} // de
- Greek Tag = Tag{lang: _el} // el
- English Tag = Tag{lang: _en} // en
- AmericanEnglish Tag = Tag{lang: _en, region: _US} // en-US
- BritishEnglish Tag = Tag{lang: _en, region: _GB} // en-GB
- Spanish Tag = Tag{lang: _es} // es
- EuropeanSpanish Tag = Tag{lang: _es, region: _ES} // es-ES
- LatinAmericanSpanish Tag = Tag{lang: _es, region: _419} // es-419
- Estonian Tag = Tag{lang: _et} // et
- Persian Tag = Tag{lang: _fa} // fa
- Finnish Tag = Tag{lang: _fi} // fi
- Filipino Tag = Tag{lang: _fil} // fil
- French Tag = Tag{lang: _fr} // fr
- CanadianFrench Tag = Tag{lang: _fr, region: _CA} // fr-CA
- Gujarati Tag = Tag{lang: _gu} // gu
- Hebrew Tag = Tag{lang: _he} // he
- Hindi Tag = Tag{lang: _hi} // hi
- Croatian Tag = Tag{lang: _hr} // hr
- Hungarian Tag = Tag{lang: _hu} // hu
- Armenian Tag = Tag{lang: _hy} // hy
- Indonesian Tag = Tag{lang: _id} // id
- Icelandic Tag = Tag{lang: _is} // is
- Italian Tag = Tag{lang: _it} // it
- Japanese Tag = Tag{lang: _ja} // ja
- Georgian Tag = Tag{lang: _ka} // ka
- Kazakh Tag = Tag{lang: _kk} // kk
- Khmer Tag = Tag{lang: _km} // km
- Kannada Tag = Tag{lang: _kn} // kn
- Korean Tag = Tag{lang: _ko} // ko
- Kirghiz Tag = Tag{lang: _ky} // ky
- Lao Tag = Tag{lang: _lo} // lo
- Lithuanian Tag = Tag{lang: _lt} // lt
- Latvian Tag = Tag{lang: _lv} // lv
- Macedonian Tag = Tag{lang: _mk} // mk
- Malayalam Tag = Tag{lang: _ml} // ml
- Mongolian Tag = Tag{lang: _mn} // mn
- Marathi Tag = Tag{lang: _mr} // mr
- Malay Tag = Tag{lang: _ms} // ms
- Burmese Tag = Tag{lang: _my} // my
- Nepali Tag = Tag{lang: _ne} // ne
- Dutch Tag = Tag{lang: _nl} // nl
- Norwegian Tag = Tag{lang: _no} // no
- Punjabi Tag = Tag{lang: _pa} // pa
- Polish Tag = Tag{lang: _pl} // pl
- Portuguese Tag = Tag{lang: _pt} // pt
- BrazilianPortuguese Tag = Tag{lang: _pt, region: _BR} // pt-BR
- EuropeanPortuguese Tag = Tag{lang: _pt, region: _PT} // pt-PT
- Romanian Tag = Tag{lang: _ro} // ro
- Russian Tag = Tag{lang: _ru} // ru
- Sinhala Tag = Tag{lang: _si} // si
- Slovak Tag = Tag{lang: _sk} // sk
- Slovenian Tag = Tag{lang: _sl} // sl
- Albanian Tag = Tag{lang: _sq} // sq
- Serbian Tag = Tag{lang: _sr} // sr
- SerbianLatin Tag = Tag{lang: _sr, script: _Latn} // sr-Latn
- Swedish Tag = Tag{lang: _sv} // sv
- Swahili Tag = Tag{lang: _sw} // sw
- Tamil Tag = Tag{lang: _ta} // ta
- Telugu Tag = Tag{lang: _te} // te
- Thai Tag = Tag{lang: _th} // th
- Turkish Tag = Tag{lang: _tr} // tr
- Ukrainian Tag = Tag{lang: _uk} // uk
- Urdu Tag = Tag{lang: _ur} // ur
- Uzbek Tag = Tag{lang: _uz} // uz
- Vietnamese Tag = Tag{lang: _vi} // vi
- Chinese Tag = Tag{lang: _zh} // zh
- SimplifiedChinese Tag = Tag{lang: _zh, script: _Hans} // zh-Hans
- TraditionalChinese Tag = Tag{lang: _zh, script: _Hant} // zh-Hant
- Zulu Tag = Tag{lang: _zu} // zu
+ Afrikaans Tag = Tag(compact.Afrikaans)
+ Amharic Tag = Tag(compact.Amharic)
+ Arabic Tag = Tag(compact.Arabic)
+ ModernStandardArabic Tag = Tag(compact.ModernStandardArabic)
+ Azerbaijani Tag = Tag(compact.Azerbaijani)
+ Bulgarian Tag = Tag(compact.Bulgarian)
+ Bengali Tag = Tag(compact.Bengali)
+ Catalan Tag = Tag(compact.Catalan)
+ Czech Tag = Tag(compact.Czech)
+ Danish Tag = Tag(compact.Danish)
+ German Tag = Tag(compact.German)
+ Greek Tag = Tag(compact.Greek)
+ English Tag = Tag(compact.English)
+ AmericanEnglish Tag = Tag(compact.AmericanEnglish)
+ BritishEnglish Tag = Tag(compact.BritishEnglish)
+ Spanish Tag = Tag(compact.Spanish)
+ EuropeanSpanish Tag = Tag(compact.EuropeanSpanish)
+ LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish)
+ Estonian Tag = Tag(compact.Estonian)
+ Persian Tag = Tag(compact.Persian)
+ Finnish Tag = Tag(compact.Finnish)
+ Filipino Tag = Tag(compact.Filipino)
+ French Tag = Tag(compact.French)
+ CanadianFrench Tag = Tag(compact.CanadianFrench)
+ Gujarati Tag = Tag(compact.Gujarati)
+ Hebrew Tag = Tag(compact.Hebrew)
+ Hindi Tag = Tag(compact.Hindi)
+ Croatian Tag = Tag(compact.Croatian)
+ Hungarian Tag = Tag(compact.Hungarian)
+ Armenian Tag = Tag(compact.Armenian)
+ Indonesian Tag = Tag(compact.Indonesian)
+ Icelandic Tag = Tag(compact.Icelandic)
+ Italian Tag = Tag(compact.Italian)
+ Japanese Tag = Tag(compact.Japanese)
+ Georgian Tag = Tag(compact.Georgian)
+ Kazakh Tag = Tag(compact.Kazakh)
+ Khmer Tag = Tag(compact.Khmer)
+ Kannada Tag = Tag(compact.Kannada)
+ Korean Tag = Tag(compact.Korean)
+ Kirghiz Tag = Tag(compact.Kirghiz)
+ Lao Tag = Tag(compact.Lao)
+ Lithuanian Tag = Tag(compact.Lithuanian)
+ Latvian Tag = Tag(compact.Latvian)
+ Macedonian Tag = Tag(compact.Macedonian)
+ Malayalam Tag = Tag(compact.Malayalam)
+ Mongolian Tag = Tag(compact.Mongolian)
+ Marathi Tag = Tag(compact.Marathi)
+ Malay Tag = Tag(compact.Malay)
+ Burmese Tag = Tag(compact.Burmese)
+ Nepali Tag = Tag(compact.Nepali)
+ Dutch Tag = Tag(compact.Dutch)
+ Norwegian Tag = Tag(compact.Norwegian)
+ Punjabi Tag = Tag(compact.Punjabi)
+ Polish Tag = Tag(compact.Polish)
+ Portuguese Tag = Tag(compact.Portuguese)
+ BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese)
+ EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese)
+ Romanian Tag = Tag(compact.Romanian)
+ Russian Tag = Tag(compact.Russian)
+ Sinhala Tag = Tag(compact.Sinhala)
+ Slovak Tag = Tag(compact.Slovak)
+ Slovenian Tag = Tag(compact.Slovenian)
+ Albanian Tag = Tag(compact.Albanian)
+ Serbian Tag = Tag(compact.Serbian)
+ SerbianLatin Tag = Tag(compact.SerbianLatin)
+ Swedish Tag = Tag(compact.Swedish)
+ Swahili Tag = Tag(compact.Swahili)
+ Tamil Tag = Tag(compact.Tamil)
+ Telugu Tag = Tag(compact.Telugu)
+ Thai Tag = Tag(compact.Thai)
+ Turkish Tag = Tag(compact.Turkish)
+ Ukrainian Tag = Tag(compact.Ukrainian)
+ Urdu Tag = Tag(compact.Urdu)
+ Uzbek Tag = Tag(compact.Uzbek)
+ Vietnamese Tag = Tag(compact.Vietnamese)
+ Chinese Tag = Tag(compact.Chinese)
+ SimplifiedChinese Tag = Tag(compact.SimplifiedChinese)
+ TraditionalChinese Tag = Tag(compact.TraditionalChinese)
+ Zulu Tag = Tag(compact.Zulu)
)